CAZyme Information: MGYG000001648_00949

Basic Information

• Species: CAG-594 sp900759985
• Lineage: Bacteria; Firmicutes; Bacilli; RF39; UBA660; CAG-594; CAG-594 sp900759985
• CAZyme ID: MGYG000001648_00949
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
597	MGYG000001648_6|CGC1	69496.63	9.1289

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001648	1268160	MAG	United States	North America

• Gene Location: Start: 38342; End: 40135 Strand: +

Full Sequence      

MSKYIHYCWFGGKQLPKLAKKCIKSWKKYLPDYEIIEWNEHNVDLDECPFIKEAYENKKW
AFVADYARTKAIYEMGGIYFDTDMLITKNVDFLLDKETFLGVEDSMMVNAAVWGASKPKT
YFAKRMLDFYQSQEHFNVNNIYKMSIPRIITKILDEFDFDPSLDEVQVLHKNIYVYPRPY
FYPLSYDFKDNQFTDKTCMIHYFDATWIPKNEQIEMKLIRRFGARPTALALKTYRFVKRN
TKRVIKAGLFPVVLYRRHKRKISDKYLESLSNALEDISKVKKSYLVMHNPAWLGVTSATI
ELFDSRVRCGELLRKKDVKQVGDAIVNANVKQVVFSAMCVGWKELALYLKSVKPELKIKT
FWHGSHSQVSEPYGWARNIEIIELHKEGVIDVMGTCKESILKFYEHEGFKTAFIRNNVRL
PRKIAGKAPEDEVRIGIYAAKSDDWRKNLFVQLAAASLIPNAVVDMVPLNPEAESFANEL
GLRLEGLNKPVPRNELLKRMCNNTINLYVTFSECAPMLPIESFEVGVPCITGNNHHYFKD
NELEKYLVVKNEENPVAIKNQINTCLENKNTVMKLYGKWKKENDALSKQSVKDFLDM

Enzyme Prediction     

No EC number prediction in MGYG000001648_00949.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	18	96	2.4e-21	0.9666666666666667

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3774	OCH1	9.10e-17	3	211	84	283	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
pfam04488	Gly_transf_sug	1.76e-15	16	100	1	93	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
pfam05704	Caps_synth	3.79e-09	3	99	48	149	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.
cd03801	GT4_PimA-like	1.49e-04	345	569	95	334	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL39234.1	2.83e-54	1	213	2	213
QIA43512.1	3.22e-54	1	223	6	231
ATP00764.1	3.22e-54	1	223	6	231
QXP69640.1	3.62e-54	1	276	2	257
QXP67480.1	3.62e-54	1	276	2	257

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001648_00949.