CAZyme Information: MGYG000001649_00234

Basic Information

• Species: UBA1409 sp900760125
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; UBA1409; UBA1409 sp900760125
• CAZyme ID: MGYG000001649_00234
• CAZy Family: GH67
• CAZyme Description: Xylan alpha-(1->2)-glucuronosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
657		75121.08	5.7723

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001649	2605663	MAG	United States	North America

• Gene Location: Start: 22538; End: 24511 Strand: -

Full Sequence      

MDYTKLWLDYKPVRKLEGKVFSIINSEKGPIISSILDELDTALTAITGVKPVTFGIDTDY
RLRLAYDPDISPEGYKVIKDGGTFSVRSGGHKGLLYGTFELLRILRTSDFDRDFTYEKSP
AMPLRMANHWDNMDGSIERGYSGNSFFFENNRIVINQRTRDYARLISSVGMNAVAINNVN
VRGEAPFLISKKHREELVTLANIFSEYCIKLFLSLNFASPVRVGGLETADPCGPAVIRWW
EDVCASIYADIPDFGGFLVKADSEGEFGPFAYGRTHADGANMLARAVKPYGGIIIWRCFV
YNCQQDWRDNVTDRAAQSYINFIGLDGKFDDNVILQIKNGPVDFQVREPVHPLFGGLKHT
NIMLEFQIAQEYTGQQRHVCYLMPEFKEVLDFDTCNGEKHSLVKDIAAGKNSACRNFGMT
AVMNTGNDVNWTGHDLAAANLYGFARLAFDPELTSEEIALEWARLTFGEDEKVLENVTKI
LMMSYSAYEKYTAPLGIGWMVNPNYHFGPNVDGYEYDRWGTYHRASHSAIGRDRSTRGTG
YAAQYPEPLKSIYNEIDTCPEELLLFFHRVRFDHIMKNGRTLIQRIYDDHFEGVQEAETM
LELWKELKGRIEGSVYERVLKRMSFQAEHAKEWRDRINTYFWRLTEVPDDKGRKIYE

Enzyme Prediction     

EC	3.2.1.139	3.2.1.131

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH67	4	653	5.1e-264	0.9955156950672646

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3661	AguA2	0.0	6	656	10	682	Alpha-glucuronidase [Carbohydrate transport and metabolism].
pfam07488	Glyco_hydro_67M	0.0	105	430	2	324	Glycosyl hydrolase family 67 middle domain. Alpha-glucuronidases, components of an ensemble of enzymes central to the recycling of photosynthetic biomass, remove the alpha-1,2 linked 4-O-methyl glucuronic acid from xylans. This family represents the central catalytic domain of alpha-glucuronidase.
pfam07477	Glyco_hydro_67C	2.93e-134	432	654	1	223	Glycosyl hydrolase family 67 C-terminus. Alpha-glucuronidases, components of an ensemble of enzymes central to the recycling of photosynthetic biomass, remove the alpha-1,2 linked 4-O-methyl glucuronic acid from xylans. This family represents the C terminal region of alpha-glucuronidase which is mainly alpha-helical. It wraps around the catalytic domain (pfam07488), making additional interactions both with the N-terminal domain (pfam03648) of its parent monomer and also forming the majority of the dimer-surface with the equivalent C-terminal domain of the other monomer of the dimer.
pfam03648	Glyco_hydro_67N	1.02e-06	6	101	1	120	Glycosyl hydrolase family 67 N-terminus. Alpha-glucuronidases, components of an ensemble of enzymes central to the recycling of photosynthetic biomass, remove the alpha-1,2 linked 4-O-methyl glucuronic acid from xylans. This family represents the N-terminal region of alpha-glucuronidase. The N-terminal domain forms a two-layer sandwich, each layer being formed by a beta sheet of five strands. A further two helices form part of the interface with the central, catalytic, module (pfam07488).
pfam02838	Glyco_hydro_20b	8.54e-05	36	106	37	109	Glycosyl hydrolase family 20, domain 2. This domain has a zincin-like fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJU15649.1	5.12e-283	3	656	5	661
QQQ91839.1	5.12e-283	3	656	5	661
ASU31294.1	5.12e-283	3	656	5	661
ANU78479.1	6.58e-283	3	656	12	668
BCJ94360.1	8.70e-281	1	656	1	658

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1MQP_A	2.70e-244	3	656	5	678	TheCrystal Structure Of Alpha-D-Glucuronidase From Bacillus Stearothermophilus T-6 [Geobacillus stearothermophilus]
1MQR_A	7.70e-244	3	656	5	678	ChainA, ALPHA-D-GLUCURONIDASE [Geobacillus stearothermophilus]
1K9E_A	1.55e-243	3	656	5	678	ChainA, alpha-D-glucuronidase [Geobacillus stearothermophilus],1K9F_A Chain A, alpha-D-glucuronidase [Geobacillus stearothermophilus]
1K9D_A	1.78e-242	3	656	5	678	The1.7 A crystal structure of alpha-D-glucuronidase, a family-67 glycoside hydrolase from Bacillus stearothermophilus T-1 [Geobacillus stearothermophilus],1L8N_A The 1.5A crystal structure of alpha-D-glucuronidase from Bacillus stearothermophilus T-1, complexed with 4-O-methyl-glucuronic acid and xylotriose [Geobacillus stearothermophilus],1MQQ_A THE CRYSTAL STRUCTURE OF ALPHA-D-GLUCURONIDASE FROM BACILLUS STEAROTHERMOPHILUS T-1 COMPLEXED WITH GLUCURONIC ACID [Geobacillus stearothermophilus]
1GQI_A	1.23e-148	2	648	2	670	Structureof Pseudomonas cellulosa alpha-D-glucuronidase [Cellvibrio japonicus],1GQI_B Structure of Pseudomonas cellulosa alpha-D-glucuronidase [Cellvibrio japonicus],1GQJ_A Structure of Pseudomonas cellulosa alpha-D-glucuronidase complexed with xylobiose [Cellvibrio japonicus],1GQJ_B Structure of Pseudomonas cellulosa alpha-D-glucuronidase complexed with xylobiose [Cellvibrio japonicus],1GQK_A Structure of Pseudomonas cellulosa alpha-D-glucuronidase complexed with glucuronic acid [Cellvibrio japonicus],1GQK_B Structure of Pseudomonas cellulosa alpha-D-glucuronidase complexed with glucuronic acid [Cellvibrio japonicus],1GQL_A Structure of Pseudomonas cellulosa alpha-D-glucuronidase complexed with glucuronic acid and xylotriose [Cellvibrio japonicus],1GQL_B Structure of Pseudomonas cellulosa alpha-D-glucuronidase complexed with glucuronic acid and xylotriose [Cellvibrio japonicus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P96105	8.72e-259	1	656	1	673	Xylan alpha-(1->2)-glucuronosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=aguA PE=1 SV=2
Q09LY5	1.48e-243	3	656	5	678	Xylan alpha-(1->2)-glucuronosidase OS=Geobacillus stearothermophilus OX=1422 GN=aguA PE=1 SV=1
B8NGU1	2.89e-178	7	653	25	691	Probable alpha-glucuronidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=aguA PE=3 SV=1
Q0CJP9	1.37e-176	7	653	26	693	Probable alpha-glucuronidase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=aguA PE=3 SV=1
Q2UFP4	3.20e-173	7	653	25	687	Probable alpha-glucuronidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=aguA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000066	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001649_00234.