CAZyme Information: MGYG000001649_01119

Basic Information

• Species: UBA1409 sp900760125
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; UBA1409; UBA1409 sp900760125
• CAZyme ID: MGYG000001649_01119
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
189		21997.8	4.2531

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001649	2605663	MAG	United States	North America

• Gene Location: Start: 15389; End: 15958 Strand: -

Full Sequence      

MFKRFCAFMLAVGFIVLLAVFMFVYMPYWFKSESYPTEYEDIVERYSDEFGIDKEFVFAV
IRTESNFNPDAVSEAGAIGLMQIIEDSFDWVSKKLGHDDLKFDDMFSPEYSIEYGCFMLG
YLYNKYGSYELAAAAYHSGMGEVSSWIESGEVDAENPDVNDFKGSNTRHYVNKIMRAYNK
YLEIEERNK

Enzyme Prediction     

No EC number prediction in MGYG000001649_01119.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	55	184	5.7e-30	0.8148148148148148

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	3.00e-60	36	180	1	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	6.27e-42	35	181	2	149	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	8.13e-32	55	179	2	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	2.55e-28	32	181	132	283	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
cd16893	LT_MltC_MltE	4.13e-28	41	179	1	162	membrane-bound lytic murein transglycosylases MltC and MltE, and similar proteins. MltC and MltE are periplasmic, outer membrane attached lytic transglycosylases (LTs), which cleave beta-1,4-glycosidic bonds joining N-acetylmuramic acid and N-acetylglucosamine in the cell wall peptidoglycan, yielding 1,6-anhydromuropeptides. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCO04775.1	2.43e-44	31	184	52	209
ADU24393.1	7.15e-44	34	184	70	223
CBK96310.1	4.39e-37	10	184	15	195
CBL34880.1	1.75e-36	10	184	15	195
AIS52076.1	5.65e-35	28	188	24	185

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FBT_A	3.48e-11	28	175	437	586	ChainA, Lytic murein transglycosylase [Pseudomonas aeruginosa]
5OHU_A	3.52e-11	28	175	466	615	TheX-ray Structure of Lytic Transglycosylase Slt from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
6FC4_A	8.68e-11	28	175	438	587	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]
6FCQ_A	8.68e-11	28	175	437	586	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCR_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCS_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCU_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]
4C5F_A	7.53e-08	38	156	173	301	Structureof Lytic Transglycosylase MltC from Escherichia coli at 2.3 A resolution. [Escherichia coli],4C5F_B Structure of Lytic Transglycosylase MltC from Escherichia coli at 2.3 A resolution. [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	3.44e-10	40	178	61	179	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
C5BCE9	7.08e-10	38	156	190	318	Membrane-bound lytic murein transglycosylase C OS=Edwardsiella ictaluri (strain 93-146) OX=634503 GN=mltC PE=3 SV=1
Q2NRB3	1.10e-08	38	126	190	280	Membrane-bound lytic murein transglycosylase C OS=Sodalis glossinidius (strain morsitans) OX=343509 GN=mltC PE=3 SV=1
Q7VKB7	1.52e-08	38	184	198	366	Membrane-bound lytic murein transglycosylase C OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) OX=233412 GN=mltC PE=3 SV=1
A8GJ50	2.03e-08	38	181	190	355	Membrane-bound lytic murein transglycosylase C OS=Serratia proteamaculans (strain 568) OX=399741 GN=mltC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999852	0.000065	0.000039	0.000000	0.000000	0.000072

TMHMM  Annotations     

start	end
7	29