CAZyme Information: MGYG000001649_01291

Basic Information

• Species: UBA1409 sp900760125
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; UBA1409; UBA1409 sp900760125
• CAZyme ID: MGYG000001649_01291
• CAZy Family: GH5
• CAZyme Description: Endoglucanase D

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
383	MGYG000001649_33|CGC1	43294.3	4.3285

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001649	2605663	MAG	United States	North America

• Gene Location: Start: 20047; End: 21198 Strand: -

Full Sequence      

MKKLISLVLCAIMTLSVFTACGDDKTPSAPNPHNDPEAAPAVTYTAEEITTAMTVGWNLG
NTLDAPDGEESWGQPLTTKDMIDKLAELGFKTIRIPTSWGKHTSGAPDYTIDEKWMDRVQ
EIVDWAMDNDMFVILNSHHDNDFYYPSAENHDEAVNYMTKIWTQVAERFKDYDQHLIFES
MNEPRLTGTQYEWNFDSNAKECLEAAKTILDCNQACVDAVRAAGGKNPDRYIMAATYSAS
PYSAINDAYELPSDPSEKILLSIHAYTPYDLAMSGEYASREFTDNSKKSIDDFVDKIYNK
YVKNGIYVVIGECGCTNKGNDDARHEWGKYFISKAKENKMPCVVWDNQHDDLGSECYALF
DRYNLEVFPSCKEYYEGIMAGLE

Enzyme Prediction     

EC	3.2.1.4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	69	348	9e-96	0.9891304347826086

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	8.10e-71	71	347	18	268	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	8.56e-46	48	369	46	382	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIF25951.1	2.20e-100	1	380	1	390
AIF26244.1	6.18e-99	1	369	9	387
AEV59736.1	9.36e-95	2	362	7	421
ACZ98609.1	1.45e-93	46	379	62	412
ADZ19876.1	8.01e-93	2	369	8	359

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6PZ7_A	1.10e-93	31	369	3	327	GH5-4broad specificity endoglucanase from Clostridium acetobutylicum [Clostridium acetobutylicum ATCC 824]
3NDY_A	4.85e-92	46	365	12	326	Thestructure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans [Clostridium cellulovorans],3NDY_B The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans [Clostridium cellulovorans],3NDY_C The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans [Clostridium cellulovorans],3NDY_D The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans [Clostridium cellulovorans],3NDZ_A The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans bound to cellotriose [Clostridium cellulovorans],3NDZ_B The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans bound to cellotriose [Clostridium cellulovorans],3NDZ_C The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans bound to cellotriose [Clostridium cellulovorans],3NDZ_D The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans bound to cellotriose [Clostridium cellulovorans]
4X0V_A	1.66e-91	53	369	47	385	Structureof a GH5 family lichenase from Caldicellulosiruptor sp. F32 [Caldicellulosiruptor sp. F32],4X0V_B Structure of a GH5 family lichenase from Caldicellulosiruptor sp. F32 [Caldicellulosiruptor sp. F32],4X0V_C Structure of a GH5 family lichenase from Caldicellulosiruptor sp. F32 [Caldicellulosiruptor sp. F32],4X0V_D Structure of a GH5 family lichenase from Caldicellulosiruptor sp. F32 [Caldicellulosiruptor sp. F32],4X0V_E Structure of a GH5 family lichenase from Caldicellulosiruptor sp. F32 [Caldicellulosiruptor sp. F32],4X0V_F Structure of a GH5 family lichenase from Caldicellulosiruptor sp. F32 [Caldicellulosiruptor sp. F32],4X0V_G Structure of a GH5 family lichenase from Caldicellulosiruptor sp. F32 [Caldicellulosiruptor sp. F32],4X0V_H Structure of a GH5 family lichenase from Caldicellulosiruptor sp. F32 [Caldicellulosiruptor sp. F32]
5H4R_A	4.68e-91	53	369	47	385	thecomplex of Glycoside Hydrolase 5 Lichenase from Caldicellulosiruptor sp. F32 E188Q mutant and cellotetraose [Caldicellulosiruptor sp. F32]
6WQP_A	9.29e-89	45	365	15	341	GH5-4broad specificity endoglucanase from Ruminococcus champanellensis [Ruminococcus champanellensis],6WQP_B GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis [Ruminococcus champanellensis],6WQV_A GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis],6WQV_B GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis],6WQV_C GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis],6WQV_D GH5-4 broad specificity endoglucanase from Ruminococcus champanellensis with bound cellotriose [Ruminococcus champanellensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P28623	1.94e-89	46	365	43	357	Endoglucanase D OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engD PE=1 SV=2
P17901	1.26e-86	53	382	54	396	Endoglucanase A OS=Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) OX=394503 GN=celCCA PE=1 SV=1
P20847	1.20e-85	38	380	31	400	Endoglucanase 1 OS=Butyrivibrio fibrisolvens OX=831 GN=end1 PE=3 SV=1
P28621	4.05e-82	45	381	41	373	Endoglucanase B OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engB PE=3 SV=1
P54937	9.78e-80	34	370	27	368	Endoglucanase A OS=Clostridium longisporum OX=1523 GN=celA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000036	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001649_01291.