CAZyme Information: MGYG000001649_01379

Basic Information

• Species: UBA1409 sp900760125
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; UBA1409; UBA1409 sp900760125
• CAZyme ID: MGYG000001649_01379
• CAZy Family: GH30
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
673	MGYG000001649_38|CGC1	74313.57	4.3874

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001649	2605663	MAG	United States	North America

• Gene Location: Start: 12387; End: 14408 Strand: +

Full Sequence      

MKSISKRLVSLALCACMMVSSSGCGAKDNNIKDEQTPNGGGMEDRIIVKPEDVNIDTTIS
ISPLNASVMNGGKFEGWGTSLCWWANRVGYSDKLAQLSADLFFGDDGLRLNIMRYNIGGG
DDPSHNHITRTDSEVPGWLYWNDKKQEYEYDYKADKNQLNVLERAYKAAGDDAIVEVFSN
SPPYFMTVSGCSSGGRDGNVNNLKDESYKDFAEYLAHVTDYIQNKLDITVTSVAPMNEPN
TNFWWYGSNKQEGCHFDEGESQSKIIELTYDALKDYDLDNVMVSASDETSTELQINEYLS
YSDKAKASIGRINTHTYNPSKIGELGQLAKDEGFNMWMSEVDGNGSVCDGEMGPALWLGE
KIISDINSLSPSAWVLWQVIDKHISKDGYNGKQDSGMIDITSGFWGTAVCDHDNNDIILT
QKYYAFGQFSRFIRPGSTIIHCGGDSLAAYDPETKELAIVVLNKSDKPKTANISLSQMKT
VGDTVKCYRTSGTMAEGEHWSALDNIYTYGKGFVAELAAQSITTYVVNGVEMGEVSLEAV
PMDNPTVTGSTPWNNCSDTADKVVDGDILTFFDGVAEGWLEIDRGSTADFNVIAYAPRTG
FEGRMTGGKFYGSKDGKKWTEIYEVTSAPTSGFNYAFLDKTYNYRYIRYDVPTGGGDYLC
NIAEVSLYKTTQK

Enzyme Prediction     

No EC number prediction in MGYG000001649_01379.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH30	70	525	5.4e-145	0.9824561403508771
CBM62	546	669	1.3e-34	0.9541984732824428

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14587	Glyco_hydr_30_2	2.95e-14	77	388	18	364	O-Glycosyl hydrolase family 30.
COG5520	XynC	2.56e-12	154	528	97	429	O-Glycosyl hydrolase [Cell wall/membrane/envelope biogenesis].
pfam00754	F5_F8_type_C	2.21e-09	546	665	1	127	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADU23821.1	7.09e-205	58	670	33	648
QTE67528.1	2.84e-163	56	527	29	510
CBK73885.1	2.45e-160	51	669	942	1639
AOZ97766.1	1.28e-126	1	525	1	579
ADL35667.1	5.33e-118	53	527	83	606

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2YB7_A	8.37e-15	537	670	1	139	ChainA, Carbohydrate Binding Family 6 [Acetivibrio thermocellus],2YB7_B Chain B, Carbohydrate Binding Family 6 [Acetivibrio thermocellus],2YFU_A Chain A, Carbohydrate Binding Family 6 [Acetivibrio thermocellus],2YFZ_A Chain A, Carbohydrate Binding Family 6 [Acetivibrio thermocellus],2YG0_A Chain A, Carbohydrate Binding Family 6 [Acetivibrio thermocellus]
5G56_A	2.12e-13	525	670	684	840	ChainA, Carbohydrate Binding Family 6 [Acetivibrio thermocellus]
3GTN_A	2.11e-07	155	531	57	393	CrystalStructure of XynC from Bacillus subtilis 168 [Bacillus subtilis],3GTN_B Crystal Structure of XynC from Bacillus subtilis 168 [Bacillus subtilis],3KL0_A Crystal structure of the glucuronoxylan xylanohydrolase XynC from Bacillus subtilis [Bacillus subtilis subsp. subtilis str. 168],3KL0_B Crystal structure of the glucuronoxylan xylanohydrolase XynC from Bacillus subtilis [Bacillus subtilis subsp. subtilis str. 168],3KL0_C Crystal structure of the glucuronoxylan xylanohydrolase XynC from Bacillus subtilis [Bacillus subtilis subsp. subtilis str. 168],3KL0_D Crystal structure of the glucuronoxylan xylanohydrolase XynC from Bacillus subtilis [Bacillus subtilis subsp. subtilis str. 168],3KL3_A Crystal structure of Ligand bound XynC [Bacillus subtilis subsp. subtilis str. 168],3KL3_B Crystal structure of Ligand bound XynC [Bacillus subtilis subsp. subtilis str. 168],3KL3_C Crystal structure of Ligand bound XynC [Bacillus subtilis subsp. subtilis str. 168],3KL3_D Crystal structure of Ligand bound XynC [Bacillus subtilis subsp. subtilis str. 168],3KL5_A Structure Analysis of a Xylanase From Glycosyl Hydrolase Family Thirty: Carbohydrate Ligand Complexes Reveal this Family of Enzymes Unique Mechanism of Substrate Specificity and Recognition [Bacillus subtilis],3KL5_B Structure Analysis of a Xylanase From Glycosyl Hydrolase Family Thirty: Carbohydrate Ligand Complexes Reveal this Family of Enzymes Unique Mechanism of Substrate Specificity and Recognition [Bacillus subtilis],3KL5_C Structure Analysis of a Xylanase From Glycosyl Hydrolase Family Thirty: Carbohydrate Ligand Complexes Reveal this Family of Enzymes Unique Mechanism of Substrate Specificity and Recognition [Bacillus subtilis],3KL5_D Structure Analysis of a Xylanase From Glycosyl Hydrolase Family Thirty: Carbohydrate Ligand Complexes Reveal this Family of Enzymes Unique Mechanism of Substrate Specificity and Recognition [Bacillus subtilis]
4FMV_A	6.38e-07	162	531	70	390	CrystalStructure Analysis of a GH30 Endoxylanase from Clostridium papyrosolvens C71 [Ruminiclostridium papyrosolvens DSM 2782]
7O0E_A	9.54e-07	101	495	46	420	ChainA, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464],7O0E_G Chain G, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0A401ETL2	7.63e-35	74	499	49	590	Exo-beta-1,6-galactobiohydrolase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=bl1,6Gal PE=1 SV=1
G2Q1N4	1.03e-06	101	495	70	444	GH30 family xylanase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Xyn30A PE=1 SV=1
Q45070	3.72e-06	155	528	88	421	Glucuronoxylanase XynC OS=Bacillus subtilis (strain 168) OX=224308 GN=xynC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000001	1.000060	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001649_01379.