CAZyme Information: MGYG000001649_01851

Basic Information

• Species: UBA1409 sp900760125
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; UBA1409; UBA1409 sp900760125
• CAZyme ID: MGYG000001649_01851
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
322		37252.38	5.2317

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001649	2605663	MAG	United States	North America

• Gene Location: Start: 921; End: 1889 Strand: -

Full Sequence      

MSDRIYTPVNPNAQECVKNVLKYLSDISFDKVVTGQHTQTMAMEELHQIKNTTGHEPALL
GFELLSYSPNINYLDTDEDCMNEIVDNFGTLKRAWEWAERKGLITFTWHWFSPIGGRSKA
FYSVNTDFDASRAVIDGTPENKALLADMDMMAGLLRPFCDKCIPIIWRPFHEGDGNWFWW
GAKGPETVKKLYRIMYDRFTNLHGLNNLIWVWNSPIPEYYPGDDTVDIISRDIYTECHVH
KDCAKEYSELTKITPQKKIALIGESGTLPDINGIHENKLGWTCFMTWSKVFCLTEKFNSY
EYLKTLYSSPYAVTKENLPELY

Enzyme Prediction     

No EC number prediction in MGYG000001649_01851.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	9	316	1.5e-95	0.9933993399339934

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	5.48e-51	9	316	1	310	Glycosyl hydrolase family 26.
COG4124	ManB2	3.80e-15	163	254	180	279	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK96616.1	5.25e-177	1	322	1	322
CBL34621.1	2.13e-176	1	322	1	322
QTE69139.1	1.26e-163	7	322	6	321
ADU22555.1	4.77e-159	1	322	1	322
AIQ67637.1	1.92e-142	7	322	8	324

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6HPF_A	4.34e-68	7	318	5	310	Structureof Inactive E165Q mutant of fungal non-CBM carrying GH26 endo-b-mannanase from Yunnania penicillata in complex with alpha-62-61-di-galactosyl-mannotriose [Yunnania penicillata]
3ZM8_A	1.48e-59	10	318	147	447	ChainA, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]
3WDQ_A	5.90e-53	7	319	33	353	Crystalstructure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus [Symbiotic protist of Reticulitermes speratus],3WDR_A Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus complexed with gluco-manno-oligosaccharide [Symbiotic protist of Reticulitermes speratus]
6HF2_A	4.38e-42	18	287	55	314	Thestructure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus [Bacteroides ovatus ATCC 8483],6HF4_A The structure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus, complexed with G1M4 [Bacteroides ovatus ATCC 8483]
6D2X_A	2.72e-38	12	287	8	308	Crystalstructure of the GH26 domain from PbGH26-GH5A endo-beta-mannanase/endo-beta-glucanase from Prevotella bryantii [Prevotella bryantii B14]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G2Q4H7	6.02e-65	10	318	176	476	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
Q5AWB7	2.96e-53	8	318	28	350	Probable mannan endo-1,4-beta-mannosidase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=manE PE=3 SV=1
P49425	3.82e-53	44	320	184	459	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
A2R6F5	9.80e-49	6	308	26	323	Mannan endo-1,4-beta-mannosidase man26A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=man26A PE=1 SV=1
P55298	9.55e-45	7	319	155	460	Mannan endo-1,4-beta-mannosidase C OS=Piromyces sp. OX=45796 GN=MANC PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001649_01851.