CAZyme Information: MGYG000001649_02225

Basic Information

• Species: UBA1409 sp900760125
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; UBA1409; UBA1409 sp900760125
• CAZyme ID: MGYG000001649_02225
• CAZy Family: GH11
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
401	MGYG000001649_126|CGC1	44110.69	4.1505

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001649	2605663	MAG	United States	North America

• Gene Location: Start: 87; End: 1292 Strand: -

Full Sequence      

MKAFSRALRMAAALAAALCVILCVSCGDSAGSGDYRVLTDCEIGEQDGYGYELWKDNGTT
SMTLKEDGKFSCEWSDINNALFRRGMKFDCTKTWQEIGNITLEYEADYNPDGNSYLALYG
WTREPLVEYYIVESWGNWRPPGGVPYATIKIDGANYDIYETTRYNQPSIDGNTTFQQYWC
VRQEKRDKGEINVGQVFASWEALGMKMGKLYEASFTVEGYQSRGSADILKNEIKIGGEIP
APAEGAGPEEPDENGYYYNCSFDSGSEGWEQRGSSSVSAVDRPDGDGKCLKVTGRQDAWN
GAGRTLRTNTFIPGNTYSFGVTAMQDSAEAVEFKLTLQYNINGQTDYAEVAAAEAAKGEW
VTLSNPEFTIPDGATGMLLYVETANGKADFYVDDAYGAVAP

Enzyme Prediction     

EC	3.2.1.8	3.1.1.72

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH11	47	228	5.5e-70	0.9887005649717514
CBM22	257	383	9.7e-29	0.9694656488549618

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00457	Glyco_hydro_11	3.91e-74	47	227	1	175	Glycosyl hydrolases family 11.
pfam02018	CBM_4_9	3.08e-22	254	387	1	134	Carbohydrate binding domain. This family includes diverse carbohydrate binding domains.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL18305.1	3.55e-138	37	399	33	402
AYF57933.1	2.77e-124	27	398	24	418
AEE64769.1	2.25e-114	40	400	36	407
AEE64770.1	3.20e-112	36	395	59	433
ADD13451.1	1.85e-111	45	399	39	402

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7AYL_A	8.28e-92	37	237	31	231	Crystalstructure of the GH11 domain of a multidomain xylanase from the hindgut metagenome of Trinervitermes trinervoides [uncultured bacterium],7AYL_B Crystal structure of the GH11 domain of a multidomain xylanase from the hindgut metagenome of Trinervitermes trinervoides [uncultured bacterium]
6KKA_A	3.96e-91	37	238	1	203	XylanaseJ mutant from Bacillus sp. 41M-1 [Bacillus sp. 41M-1],6KKA_B Xylanase J mutant from Bacillus sp. 41M-1 [Bacillus sp. 41M-1]
6KJL_A	1.64e-90	37	238	2	204	XylanaseJ from Bacillus sp. strain 41M-1 [Bacillus sp. 41M-1],6KJL_B Xylanase J from Bacillus sp. strain 41M-1 [Bacillus sp. 41M-1]
2DCJ_A	3.71e-90	37	238	28	230	Atwo-domain structure of alkaliphilic XynJ from Bacillus sp. 41M-1 [Bacillus sp. 41M-1],2DCJ_B A two-domain structure of alkaliphilic XynJ from Bacillus sp. 41M-1 [Bacillus sp. 41M-1],2DCK_A A tetragonal-lattice structure of alkaliphilic XynJ from Bacillus sp. 41M-1 [Bacillus sp. 41M-1]
7AYP_A	4.36e-89	37	237	3	203	Structureof a GH11 domain refined from the X-ray diffraction data of a GH11-CBM36-1 crystal. [uncultured bacterium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q53317	9.78e-102	40	399	34	403	Xylanase/beta-glucanase OS=Ruminococcus flavefaciens OX=1265 GN=xynD PE=3 SV=2
Q8GJ44	2.11e-91	36	244	32	241	Endo-1,4-beta-xylanase A OS=Thermoclostridium stercorarium OX=1510 GN=xynA PE=1 SV=2
P17137	2.87e-90	36	236	60	260	Endo-1,4-beta-xylanase OS=Clostridium saccharobutylicum OX=169679 GN=xynB PE=3 SV=1
P33558	2.54e-88	36	244	32	242	Endo-1,4-beta-xylanase A OS=Thermoclostridium stercorarium OX=1510 GN=xynA PE=1 SV=2
P83513	7.71e-86	42	237	22	217	Bifunctional xylanase/deacetylase OS=Pseudobutyrivibrio xylanivorans OX=185007 GN=xyn11A PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000001	0.000161	0.999878	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001649_02225.