CAZyme Information: MGYG000001649_02269

Basic Information

• Species: UBA1409 sp900760125
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; UBA1409; UBA1409 sp900760125
• CAZyme ID: MGYG000001649_02269
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
298	MGYG000001649_138|CGC1	34336.79	5.2193

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001649	2605663	MAG	United States	North America

• Gene Location: Start: 204; End: 1100 Strand: -

Full Sequence      

MNFKLSNHNADACAKQLFEYLCSVYGKKILTAQQECGHHEKSNMEVDFIKEKTGHLPAIR
GLDFISDGFGQIVERAKKWHALGGIVTICWHCGINGGGYKQSQEDVPDFDKLFEDGSPEQ
TAMLESWDRAANALAQLRDAGIPVLWRPFHEFDGGWFWWGKGGAECFIRLWRMMYEHFTK
QFNLTNLIWVLGYADDVREGWYVGDNYCDIVGSDTYRGGVHKPGFDRLSEVAPNKPRCFH
ECGILPKIEEFENSGCMWMWFMIWHTKWLFDNDEESLKAFYNSDKALTLDDTARDLNA

Enzyme Prediction     

No EC number prediction in MGYG000001649_02269.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	6	291	5e-84	0.9966996699669967

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	5.90e-32	7	291	2	311	Glycosyl hydrolase family 26.
COG4124	ManB2	1.77e-06	140	216	178	256	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCN30282.1	8.55e-93	4	290	5	294
ADU20874.1	2.59e-86	1	291	163	458
AWB26443.1	5.44e-78	5	291	48	335
ATC26721.1	1.92e-72	5	291	1	293
AOW25662.1	2.71e-66	5	293	1	295

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZM8_A	1.34e-48	1	291	141	446	ChainA, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]
6Q75_A	6.89e-44	7	291	25	326	Thestructure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75],6Q75_B The structure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75]
3WDQ_A	2.39e-42	11	290	40	350	Crystalstructure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus [Symbiotic protist of Reticulitermes speratus],3WDR_A Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus complexed with gluco-manno-oligosaccharide [Symbiotic protist of Reticulitermes speratus]
6HF2_A	1.22e-41	4	265	44	315	Thestructure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus [Bacteroides ovatus ATCC 8483],6HF4_A The structure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus, complexed with G1M4 [Bacteroides ovatus ATCC 8483]
6D2X_A	1.09e-37	5	265	4	309	Crystalstructure of the GH26 domain from PbGH26-GH5A endo-beta-mannanase/endo-beta-glucanase from Prevotella bryantii [Prevotella bryantii B14]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G2Q4H7	3.30e-46	1	291	170	475	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
P49425	2.95e-44	4	291	145	456	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
Q5AWB7	5.16e-32	7	291	30	349	Probable mannan endo-1,4-beta-mannosidase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=manE PE=3 SV=1
P55297	2.51e-31	1	291	154	460	Mannan endo-1,4-beta-mannosidase B OS=Piromyces sp. OX=45796 GN=MANB PE=2 SV=1
P55298	4.66e-31	1	291	152	458	Mannan endo-1,4-beta-mannosidase C OS=Piromyces sp. OX=45796 GN=MANC PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000026	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001649_02269.