CAZyme Information: MGYG000001650_01135

Basic Information

• Species: F23-B02 sp900760205
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; F23-B02; F23-B02 sp900760205
• CAZyme ID: MGYG000001650_01135
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
794		86207.05	7.5697

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001650	1589868	MAG	United States	North America

• Gene Location: Start: 155; End: 2539 Strand: +

Full Sequence      

MKYKALIEKMTLEEKASLCSGRDFWNTKAIERLGIPSMMLTDGPHGLRKQGGRADHLGLN
RSIPATCFPTASAAANSWDEELIEEMGKRLGLEARAEKVSVLLGPGVNIKRSPLCGRNFE
YYSEDPYLAGKCAAALIRGIQSNGISACVKHFAANSQELLRMTNDSVVDERTLREIYLPA
FETAVREGGVGCVMTSYNRVNGVYANENTHLLQDILFGDWGYRGMVVTDWGGDNDRVRGL
IAGDHLEMPGTRGDTDRQIVSAVRSGELSQRLLDERVEVLLDTVFSAGAAFKENVSFSKA
GHHAFAKRLAAECAVLLKNEGGILPIKPGSRVAVIGDFAETPRYQGAGSSHIEPTMLDNG
LAELKKAGVNVVGFSRGFKRMGGESKRLLREACRLAESADIVLLWLGLDEGSEAEGADRT
HMRLPENQLRLLGELKKVNPNIAAVLSCGSAVETDWDENVKAVLYAGLGGQAGAGAVAEL
IAGKQNPSGKLAETLPYRLEDTPCANYYPGTEATSEYREGLYVGYRYYDTADVPVKYPFG
FGLSYTSFEYGGMSLDGAGVSFTVKNSGPVAGAEVAQVYVAPKCGGVFRPKKELRGFARV
YLEPGESRSVHIELPERAFAYWNTLTGGWVVEGGSYEVLVGSSSRDIRLSAEITKPGDGA
PDPYADGVFAPYRSADIKNVPDASFAALLGRDIPPRLWDRSAPLEYNSAILQGAYLKRGL
GRLIYKLVDIVRRVLLLLGDKNGANNAMFALSLPYRGLARFTGYFTEARARALVRVINRE
KGALRGFLSAGRDK

Enzyme Prediction     

EC	3.2.1.21	3.2.1.-	3.2.1.45

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	28	234	3e-68	0.8935185185185185

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	5.23e-86	32	648	101	758	beta-glucosidase BglX.
COG1472	BglX	2.55e-66	22	340	47	365	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	6.93e-52	4	641	54	769	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	3.33e-45	314	545	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	1.89e-36	32	281	63	314	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCN29197.1	1.69e-296	3	778	4	780
AZK48658.1	2.56e-296	1	763	1	766
ADL34828.1	8.10e-295	1	763	1	760
AZK49185.1	2.01e-294	1	763	1	765
AST98591.1	7.55e-294	1	763	1	766

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	8.30e-234	4	653	6	666	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.29e-195	7	694	9	720	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	1.32e-120	2	654	3	712	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	1.98e-119	2	654	3	712	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
3AC0_A	1.07e-104	6	653	9	834	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P14002	4.55e-233	4	653	6	666	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
F6C6C1	8.68e-189	7	666	9	683	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
E7CY69	7.74e-187	7	666	9	683	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
P27034	2.01e-131	6	663	5	818	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
A7LXS8	5.93e-123	7	648	50	738	Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02644 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000075	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001650_01135.