CAZyme Information: MGYG000001652_00658

Basic Information

• Species: V9D3004 sp002349525
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; V9D3004; V9D3004 sp002349525
• CAZyme ID: MGYG000001652_00658
• CAZy Family: GH10
• CAZyme Description: Endo-1,4-beta-xylanase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
415		46977.74	4.5255

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001652	2035634	MAG	United States	North America

• Gene Location: Start: 31125; End: 32372 Strand: -

Full Sequence      

MTFKKKIVTCMASAMAMAVLLAGCGNSNNEQTATSEPQVTEAAEDKAEETAAPTTETAAE
DEIQNKDASTMSLKEAYKDLFDIGVAVNSWQLADKKVLARITKDYSTFTCENEMKPDYLL
DHNASMEAKDGMPVLTTEKLDEILTMAEDAGLKMRGHTLVWHSQTPEWLFREGYDDGKDY
VDKDTMLKRMESYIKKVITYCQEKHPGVVYAWDVVNECASDNKGLRTDSLWYKVIGEEYI
EKAFEYARKYADKDVKLFINDYGMTSPERRKTYTTLVKKIWDQGNIDGIGMQSHHDRENF
DVAQIETSIYAFSAIADGIEIQLTELDMHYNDNSEAAMKEQAENYKKLFDLLVNVDTKGH
ANITNVTFWGLDDEHTWLTGFKKETSYPLLYDKDGNAKPSYFAIIEAAEAAKAAQ

Enzyme Prediction     

EC	3.2.1.8	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH10	72	407	1.1e-93	0.9966996699669967

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00331	Glyco_hydro_10	3.37e-104	73	402	1	306	Glycosyl hydrolase family 10.
smart00633	Glyco_10	2.77e-90	114	402	1	261	Glycosyl hydrolase family 10.
COG3693	XynA	3.92e-69	103	401	56	334	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADL33823.1	3.30e-89	71	408	1	338
CUH92237.1	7.01e-89	72	405	262	600
CAA43712.1	4.05e-87	71	408	1	338
BCS82260.1	6.25e-83	63	407	60	416
ADU22101.1	4.87e-82	63	412	44	389

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6D5C_A	4.58e-69	67	407	17	350	Structureof Caldicellulosiruptor danielii GH10 module of glycoside hydrolase WP_045175321 [Caldicellulosiruptor danielii],6D5C_B Structure of Caldicellulosiruptor danielii GH10 module of glycoside hydrolase WP_045175321 [Caldicellulosiruptor danielii],6D5C_C Structure of Caldicellulosiruptor danielii GH10 module of glycoside hydrolase WP_045175321 [Caldicellulosiruptor danielii]
5OFJ_A	1.31e-68	72	407	10	338	Crystalstructure of N-terminal domain of bifunctional CbXyn10C [Caldicellulosiruptor bescii DSM 6725]
7NL2_A	1.91e-68	72	406	11	339	ChainA, Beta-xylanase [Pseudothermotoga thermarum DSM 5069],7NL2_B Chain B, Beta-xylanase [Pseudothermotoga thermarum DSM 5069]
5OFK_A	1.03e-67	72	407	10	338	Crystalstructure of CbXyn10C variant E140Q/E248Q complexed with xyloheptaose [Caldicellulosiruptor bescii DSM 6725],5OFL_A Crystal structure of CbXyn10C variant E140Q/E248Q complexed with cellohexaose [Caldicellulosiruptor bescii DSM 6725]
6FHE_A	6.88e-65	73	405	13	339	Highlyactive enzymes by automated modular backbone assembly and sequence design [synthetic construct]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P26223	8.11e-88	71	408	1	338	Endo-1,4-beta-xylanase B OS=Butyrivibrio fibrisolvens OX=831 GN=xynB PE=3 SV=1
P23557	6.84e-74	114	407	1	301	Putative endo-1,4-beta-xylanase OS=Caldicellulosiruptor saccharolyticus OX=44001 PE=3 SV=1
Q60037	2.94e-69	72	405	369	690	Endo-1,4-beta-xylanase A OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=xynA PE=1 SV=1
Q60042	9.40e-68	65	405	358	686	Endo-1,4-beta-xylanase A OS=Thermotoga neapolitana OX=2337 GN=xynA PE=1 SV=1
P10474	3.56e-62	67	407	39	372	Endoglucanase/exoglucanase B OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=celB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000050	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001652_00658.