CAZyme Information: MGYG000001654_00817

Basic Information

• Species: UMGS856 sp900760305
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UMGS856; UMGS856 sp900760305
• CAZyme ID: MGYG000001654_00817
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
324	MGYG000001654_32|CGC1	34117.79	4.4618

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001654	2698113	MAG	United States	North America

• Gene Location: Start: 9252; End: 10226 Strand: +

Full Sequence      

MTLEEKAGQVFFVRCNKASALSDIARYKVGGLILFASNAKGETKASLSATLADYQKASDI
PLLIGTDEEGGTVNRLSLYKAFRAVPFHSPQELMQEGGLALVSSDATEKAQLLKSLGLNV
NLAPVCDVSTDPADYIYPRTLGKPAAETADYVRAVVQATKAQGVGSVLKHFPGYGNNADT
HTGIATDTRPFESFEQSDFLPFEAGIAAGAGGILVSHNIVTCMDEDLPASLSPAVHAVLR
DRLGFDGVVMTDDLAMDAIGDYTGSEQAAVLALNAGNDLLIATDFDVQIPAVIAAVKNGG
IPSARLDEAVMRVLLWKMDLGLIA

Enzyme Prediction     

No EC number prediction in MGYG000001654_00817.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	55	280	3.1e-46	0.9722222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00933	Glyco_hydro_3	7.43e-60	2	314	1	314	Glycosyl hydrolase family 3 N terminal domain.
COG1472	BglX	2.92e-53	1	322	1	317	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PRK05337	PRK05337	3.78e-30	29	280	26	277	beta-hexosaminidase; Provisional
PRK15098	PRK15098	1.64e-09	98	322	123	358	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHQ63470.1	2.48e-146	1	323	92	414
ASW43722.1	7.08e-144	1	323	66	388
QWT55932.1	8.96e-137	1	323	115	437
BCJ98858.1	1.61e-134	1	323	135	457
QOX64982.1	4.04e-134	1	324	68	391

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6K5J_A	4.18e-42	1	317	11	337	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	9.62e-38	1	322	42	398	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
5BU9_A	1.63e-37	1	317	5	337	Crystalstructure of Beta-N-acetylhexosaminidase from Beutenbergia cavernae DSM 12333 [Beutenbergia cavernae DSM 12333],5BU9_B Crystal structure of Beta-N-acetylhexosaminidase from Beutenbergia cavernae DSM 12333 [Beutenbergia cavernae DSM 12333]
3LK6_A	3.92e-37	1	322	16	372	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	4.83e-37	1	322	46	402	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40406	5.27e-37	1	322	42	398	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
L7N6B0	6.33e-34	5	317	63	380	Beta-hexosaminidase LpqI OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=lpqI PE=1 SV=1
A0A0H3M1P5	1.70e-33	5	317	63	380	Beta-hexosaminidase LpqI OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) OX=410289 GN=lpqI PE=3 SV=1
Q0AF74	1.64e-31	29	286	28	287	Beta-hexosaminidase OS=Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57) OX=335283 GN=nagZ PE=3 SV=1
B0U3L0	2.49e-31	29	281	24	276	Beta-hexosaminidase OS=Xylella fastidiosa (strain M12) OX=405440 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000030	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001654_00817.