CAZyme Information: MGYG000001657_00141

Basic Information

• Species: RC9 sp900760425
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9; RC9 sp900760425
• CAZyme ID: MGYG000001657_00141
• CAZy Family: GH125
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1284		145073.89	5.1199

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001657	2980281	MAG	United States	North America

• Gene Location: Start: 1246; End: 5100 Strand: -

Full Sequence      

MKKTLFSVCAALLFSFISAAAGKDITPPAYPLVSVDPYFSIWSFTDNAYEQQTVHWTGKP
QPMISAIRVDGTVYRTLGKTLPRVECILPTVSMEKWTARYTVDSKPAGDWTAENYDDSSW
TEGPGAFGSRDMPCIGTEWKGNNRDIWVRRSVVLDRDLSKEDVYFEYSHDDVFELYINGT
EVANTGNTWKNHIVSQVPEEIRKGFKKGSTVTFAAHCHNTIGGSYVDFGMYLMHPEDAME
QNAEQLSVKVLPTNTVYSFRCGGVDLEMSFTAPLLLEDIELCSRPVNYVNWKVKSNDGKT
HSVQLYYEASPQIAVNEEVVPVISELGCKKGIAYAKTGTVAQPILATKGDNVRIDWGYFH
IASPEGKGRFTIGDYYGSKLEFARDGKVSSSSDRLQTGNFVLDRVALSYTNDLGNVGKEE
VCDYLMLAYDDIYSLKLFGKDLRPYWNRNGDRTIYGELRKAADDYSSLMERCSSFDREML
AEAEEVGGHSYAQLCALAYRQSICAHKLAQAPNGDLLFISKENFSCGCAATVDVTYPSAP
LFLRYNPEFLKGMLNPIFLYSESGRWEKPFAAHDMGTYPILNGQTYGGNMPVEECGNMVV
LTGAIAAVEGNAQYAAKHWDILTQWTDYLVEHGQDPANQLCTDDFAGHFAHNTNLSIKAI
EGVASYAMLADMLSLKDVAEKYHSKAVEMARIWKENAFDGDHYRLTFDKSGTWSQKYNLV
WDRMLGLNVFDEDIIDTEIRYYLGKQNKYGLPLDSRKGYTKTDWIMWTATMARDKATFEK
FIDPLFEFFDKTEVRVPMSDFIQTFELNNFGFRARSVVGGYFIKMLDEMLKRNGHGIRYT
SCRPAPEDRLFCSSSVDVAISEVQGLLKPGKLSWMFGNCFPNTLDTTVHYSEDENGQPDT
FVYTGDIHAMWLRDSGAQVWPYVQFAKDDAELRRLIAGVINRQFSQICIDPYANAFNCGP
TGGEWQSDRTKMNPWLHERKWELDSQCYPIRLAYEYWKVTGDVSVFSETWVKAMRSILDT
MREQQRKEGHGSYTFERKTERQLDTKSCNGLGNPCRPCGLIASSFRPSDDACTFEFLVPS
NFFAVSVLRKAAEILKGVNGEYKMADECLALADEVEDALYKYAVVKHPVYGKIYAYEVDG
YGNALLMDDSNAPSLLSLPYLCDVKSSDRIYRNTRRFVLSGDNPYFFKGTAAEGIGGPHV
GYDMIWPMSIIMRALTSTDDKEIEQCIRTLVNTDAGTGFMHESFHKDNPVNYTRPWFAWA
NTLFGELVLKLVNDGKAELLDKCN

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH125	871	1269	7.5e-178	0.9925373134328358

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3538	COG3538	0.0	848	1271	2	422	Meiotically up-regulated gene 157 (Mug157) protein (function unknown) [Function unknown].
pfam06824	Glyco_hydro_125	0.0	871	1269	3	416	Metal-independent alpha-mannosidase (GH125). This family, which contains bacterial and fungal glycoside hydrolases, is also known as GH125. They function as metal-independent alpha-mannosidases, with specificity for alpha-1,6-linked non-reducing terminal mannose residues. Structurally this family is part of the 6 hairpin glycosidase superfamily.
pfam16335	DUF4965	1.75e-93	486	655	1	174	Domain of unknown function (DUF4965). This family consists of uncharacterized proteins around 840 residues in length and is mainly found in various Bacteroides species. Several proteins in this family are annotated as Glutaminases, but the function of this protein is unknown.
pfam08760	DUF1793	2.46e-71	662	826	2	169	Domain of unknown function (DUF1793). This presumed domain is found at the C-terminus of a glutaminase protein from fungi. This domain is also found as a single domain protein in Bacteroides thetaiotaomicron.
pfam17168	DUF5127	9.82e-60	253	482	1	226	Domain of unknown function (DUF5127).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCA48091.1	4.83e-259	140	826	11	697
QUT73989.1	1.82e-221	843	1281	46	484
QRO24558.1	4.94e-221	842	1281	42	481
AUI48770.1	1.49e-220	843	1281	47	485
QCQ35487.1	1.49e-220	843	1281	47	485

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2P0V_A	1.66e-204	839	1281	39	478	Crystalstructure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482],2P0V_B Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482]
3ON6_A	3.39e-204	839	1281	19	458	Crystalstructure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483],3ON6_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483]
3P2C_A	2.03e-203	843	1281	21	460	Crystalstructure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483],3P2C_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483]
6RQK_A	5.99e-124	862	1278	18	429	Crystalstructure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13],6RQK_B Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13]
5M7I_A	3.15e-123	862	1278	18	429	Crystalstructure of GH125 1,6-alpha-mannosidase mutant from Clostridium perfringens in complex with 1,6-alpha-mannobiose [Clostridium perfringens str. 13],5M7Y_A Crystal structure of GH125 1,6-alpha-mannosidase mutant from Clostridium perfringens in complex with 1,6-alpha-mannotriose [Clostridium perfringens str. 13]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q10449	1.75e-103	843	1282	51	506	Meiotically up-regulated gene 157 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug157 PE=1 SV=1
Q2U4L7	5.20e-73	245	826	97	689	Glutaminase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gtaA PE=1 SV=2
D4AMT2	7.64e-41	185	822	56	779	Probable glutaminase ARB_05535/05536 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_05535/05536 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000464	0.998642	0.000306	0.000212	0.000178	0.000164

TMHMM  Annotations     

start	end
5	22