CAZyme Information: MGYG000001657_00302

Basic Information

• Species: RC9 sp900760425
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9; RC9 sp900760425
• CAZyme ID: MGYG000001657_00302
• CAZy Family: GH127
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
662	MGYG000001657_10|CGC1	76118.28	4.8422

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001657	2980281	MAG	United States	North America

• Gene Location: Start: 23937; End: 25925 Strand: +

Full Sequence      

MKRYLLFPFIMIASMTAALSSCSTQENEAIQPLAYSEMRLGAVRPEGWLKEMLERQRDGM
TSRMDVLYPSVMGSRNGWLGGDGDQWERGPYWIDGLVPLAYILDDEELKQKARPWVEWAL
ASQQEDGFFGPSVDYGPETGLQRNNSRDWWPRMVVLKYMQQYYSATEDVRVLDFMKRYFR
YQLETLPQVPLGNWTFWAEYRACDNLNSVLWLYRKTGEPWLIDLARILHSQSYDYVDMFL
NTDKLSTFGTIHCVNLAQGIKEPVIWWQVEPQQKYIDAVKKGFADIRKYNGFPCGMYGGD
EALHGNNPTQGSELCSAVELMYSLEEMIKVTGDLQFVEHLEKIAFNALPTQITDDFMARQ
YFQQANQVMITRDIRNFDINHAESDLVFGLLTGYPCCTSNLHQAWPKFTQNLWYTTSDGG
LAALAFSPCRVDADIDGTAVTVREVTRYPMEETVRFEFATDRPVRFPFRFRIPSWAVSPQ
ISVNGVREPVPESGTVVSLDREWRDGDVVELSFPMKVTTDRWYENSISVERGPLVYALKI
KEKWVKKDNSADRVRGDFYYEVYPESPWNYGIIDFEDAGKAFEVSTDSTKLAGKWYWNTE
SAPISIRAEAKRIPSWKLHNNSAGPLPYSKMYGNGTAGQPVETITLIPYGCSTLRISEFP
VI

Enzyme Prediction     

No EC number prediction in MGYG000001657_00302.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	310	537	7.7e-32	0.42938931297709926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	2.00e-55	91	537	62	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	3.08e-24	105	538	84	502	Uncharacterized conserved protein, DUF1680 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARS39276.1	8.51e-155	1	662	1	648
QDW25584.1	3.40e-151	1	662	4	650
QXU43103.1	1.74e-150	1	662	1	647
ALL07583.1	6.17e-149	34	662	39	651
QPH39723.1	8.83e-148	8	662	12	649

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QJY_A	3.47e-15	307	539	327	562	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	9.71e-14	307	539	327	562	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
5MQO_A	1.36e-13	82	539	100	609	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]
6EX6_A	5.17e-10	93	539	76	547	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000064	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001657_00302.