CAZyme Information: MGYG000001657_00465

Basic Information

• Species: RC9 sp900760425
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9; RC9 sp900760425
• CAZyme ID: MGYG000001657_00465
• CAZy Family: GH89
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
877	MGYG000001657_16|CGC1	101427.24	5.3172

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001657	2980281	MAG	United States	North America

• Gene Location: Start: 26311; End: 28944 Strand: +

Full Sequence      

MLFYPFFVQFFLMDYKVMAIFADINCFIMRYILTTLLCLALTLPVSAKGNKKSAQEKAVK
GVIERTLGYFPDKLYISVTEPTEDRQEYFSTEVKDGKLYIEGSSIVAACRGFYDYVKSNG
YGLVTWSINNISLPDRFQDQAKKIVVTPFRHRQYMNVCTFGYTMPYWKWDEWQKELDWMA
LHGIDMPLSPIGSEAIFARVWRQLGLTEEEIGEFVTGGAHFPWFRMGNMSRLDGGLSQSY
YDTSIALEHKIVDRMNELGMSPIYNAFAGFVPKAIGRLYPDVELIRTGWGGGEYYVSTFI
KPETDLYKKISLMYIKEWEKEFGKGKYYLADSFNEMDIPFAEKGTQERFSQLASYGKELY
SSIRGANPDAVWVIQGWMFGYQRHIWDPESIRALFSDVPDDKMLLLDLSVDFNYGIWQNE
YTWNYAPKIFGKNWIYSTVPNFGGRTAPIGDLEFYLNGHLKALGSSNKGNLIGYGTAPEG
VESNEVTYEAIADAAWSLYYKDTDKWLKDYSVARYGKYPEALDIFWKKMRKSSNMICSSR
AQYRLQKRPIDLLGGRYDTSGDHFEAIEAFIGCAEELGDNAVYRTDLAYWAGIYAFGKAD
ILVEKIHECYLKGDNEAAEQYEERFRKLMLMADAFMESHPTSRLQRWCDFARSWGTTAEE
QDRYETNARRLVTVWGPGKGPDGLNDYACRIWSGVIRDYYLPRWENYFESRKSGVPFDFN
AWEYKFAEEHRPLSPATVYSDICAEARSMVAYCSDIRREEDYTGLLGWSGMELSDSSSRV
IHFVTPEALNRIKGIRFTHLRGEDSVRLKKIQINVAGWVRTIKDVDIVIGKDNPVVEVEL
DVRPDGKRYEFSYMHIVLDETRRMMDSNVSIEWILKD

Enzyme Prediction     

No EC number prediction in MGYG000001657_00465.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH89	95	730	2e-185	0.9653092006033183

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam05089	NAGLU	2.71e-152	152	497	1	332	Alpha-N-acetylglucosaminidase (NAGLU) tim-barrel domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This central domain has a tim barrel fold.
pfam12972	NAGLU_C	6.98e-55	506	738	1	250	Alpha-N-acetylglucosaminidase (NAGLU) C-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This C-terminal domain has an all alpha helical fold.
pfam12971	NAGLU_N	1.03e-16	57	136	1	79	Alpha-N-acetylglucosaminidase (NAGLU) N-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This N-terminal domain has an alpha-beta fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO23473.1	1.79e-242	88	819	55	781
QAA35476.1	1.61e-229	42	819	16	792
QBH17768.1	4.54e-229	42	819	16	792
QWP65832.1	4.54e-229	42	819	16	792
QHV52433.1	9.08e-229	42	819	16	792

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XWH_A	1.74e-99	52	717	2	669	Crystalstructure of the human N-acetyl-alpha-glucosaminidase [Homo sapiens]
2VC9_A	5.37e-76	46	707	163	820	Family89 Glycoside Hydrolase from Clostridium perfringens in complex with 2-acetamido-1,2-dideoxynojirmycin [Clostridium perfringens],2VCA_A Family 89 glycoside hydrolase from Clostridium perfringens in complex with beta-N-acetyl-D-glucosamine [Clostridium perfringens],2VCB_A Family 89 Glycoside Hydrolase from Clostridium perfringens in complex with PUGNAc [Clostridium perfringens],2VCC_A Family 89 Glycoside Hydrolase from Clostridium perfringens [Clostridium perfringens]
7MFK_A	6.03e-76	46	707	171	828	ChainA, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124],7MFL_A Chain A, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124]
4A4A_A	4.94e-75	46	707	186	843	CpGH89(E483Q, E601Q), from Clostridium perfringens, in complex with its substrate GlcNAc-alpha-1,4-galactose [Clostridium perfringens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P54802	1.64e-98	52	717	25	692	Alpha-N-acetylglucosaminidase OS=Homo sapiens OX=9606 GN=NAGLU PE=1 SV=2
Q9FNA3	2.45e-88	53	751	43	802	Alpha-N-acetylglucosaminidase OS=Arabidopsis thaliana OX=3702 GN=NAGLU PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.994639	0.005225	0.000083	0.000006	0.000006	0.000057

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001657_00465.