CAZyme Information: MGYG000001657_01271

Basic Information

• Species: RC9 sp900760425
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9; RC9 sp900760425
• CAZyme ID: MGYG000001657_01271
• CAZy Family: GH88
• CAZyme Description: Unsaturated chondroitin disaccharide hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
394	MGYG000001657_67|CGC1	44672.75	5.2869

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001657	2980281	MAG	United States	North America

• Gene Location: Start: 9949; End: 11133 Strand: -

Full Sequence      

MKKYFHLMTALALAVSCTPKEPMDALAGRVFSVAKEQCMQMEERLTDTTMPRSIGKDGEF
VSSNIKWWCSGFYPGTLWYIYEYTGDEEIRRLATASTLKLEPLQYKAKDHDLGFQMNCSY
GNAYRLTGEQRFLGPIYNSAMALAERFSPVTGTIRSWDFVIKGRDWKYPVIIDNMMNLEH
LLNAAALFKADTLKSIAVTHANTTICNHFRPDHTCFHLVDYDPEDGSVRHKETVQGYADS
SAWARGQAWALYGYTMMFRLTDQEHYLIQAENIADMLAEKLPSDGIPYWDFNAPDIPDAP
RDASAAAVMASAFVDLSRLTTKECDKKRYLGIAERQIRTLASEEYLASPGENCNFILKHS
VGNLPGDSEVDVPLTYADYYFLEAIIKYITPTDK

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH88	63	388	7.5e-121	0.9878419452887538

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	1.33e-11	43	265	3	212	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK62765.1	6.69e-198	23	393	1	371
QDO70964.1	5.41e-179	1	388	1	385
QRM99493.1	1.17e-178	11	388	11	388
QUT31753.1	1.17e-178	11	388	11	388
QUT90613.1	1.55e-178	1	388	1	385

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WIW_A	5.64e-108	37	388	42	388	Crystalstructure of unsaturated glucuronyl hydrolase specific for heparin [Pedobacter heparinus DSM 2366]
2ZZR_A	8.80e-43	68	388	68	389	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae]
3ANJ_A	8.99e-43	68	388	69	390	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III]
3WUX_A	1.25e-42	68	388	69	390	Crystalstructure of unsaturated glucuronyl hydrolase mutant D115N/K370S from Streptococcus agalactiae [Streptococcus agalactiae NEM316]
3ANI_A	4.72e-42	68	388	69	390	Crystalstructure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III],3ANK_A Crystal structure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae complexed with dGlcA-GalNAc6S [Streptococcus agalactiae serogroup III]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KLZ3	4.11e-93	51	385	59	391	Unsaturated glucuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21900 PE=1 SV=1
Q8E372	4.92e-42	68	388	69	390	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=gbs1889 PE=1 SV=1
Q9A0T3	1.38e-40	51	388	53	391	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pyogenes serotype M1 OX=301447 GN=ugl PE=1 SV=1
Q9RC92	1.74e-39	51	387	25	363	Unsaturated glucuronyl hydrolase OS=Bacillus sp. (strain GL1) OX=84635 GN=ugl PE=1 SV=1
Q8DR77	9.56e-38	68	388	67	388	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=ugl PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000003	0.001633	0.998420	0.000001	0.000001	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001657_01271.