CAZyme Information: MGYG000001657_01732

Basic Information

• Species: RC9 sp900760425
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9; RC9 sp900760425
• CAZyme ID: MGYG000001657_01732
• CAZy Family: GH109
• CAZyme Description: Glycosyl hydrolase family 109 protein 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
463		51967.01	5.1413

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001657	2980281	MAG	United States	North America

• Gene Location: Start: 2968; End: 4359 Strand: +

Full Sequence      

MKKVFGIILAAALCLTSVSCCRSDGPYRIMDGVIVFDEPAPQPGQEDMLAFAAEPIDTVR
VGFVGLGMRGPGAVRRFTYLEGVKIVALCDLEPDRASAAQKILLDKGLPEAAEYSGEDGW
KQLCERNDIDLVYICTNWQTHVDMAVYAMEHGKHVAVEVPAATSVKDCWRLVDTSERTRR
HCMMLENCVYDFFELTTLNMAQQGVLGEILHVEGSYIHNLEEFWSEYHDNWRLEFNQGHR
GDVYATHGLGPDCQVLGIHRGDRMEYLVSMDTKSVNGLETAGKSMGSSTFANGDQTTTMI
RTAGEKTILLQHNVYTPRPYDRMYQVVGTKGYAQKYPVSGYAFEPEQIEEAVPDHENLSA
HSFVPVEVRDDLMKRYRHPIAKDIEEKAKEVGGHGGMDFIMDYRLIYCLRNGLPLDQDVY
DAAEWSCIGELTAASIENGSKPVKVPDFTRGRWRKLNGLHFAL

Enzyme Prediction     

No EC number prediction in MGYG000001657_01732.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	55	455	4.8e-164	0.9924812030075187

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	3.22e-23	58	333	3	257	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	2.95e-13	59	184	1	118	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
PRK10206	PRK10206	3.16e-06	127	216	63	152	putative oxidoreductase; Provisional
PRK11579	PRK11579	7.26e-06	57	232	3	164	putative oxidoreductase; Provisional
COG4091	COG4091	0.003	47	155	7	129	Predicted homoserine dehydrogenase, contains C-terminal SAF domain [Amino acid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFL77663.1	4.51e-247	1	463	1	463
BBL01207.1	2.83e-241	1	463	1	464
BBL11909.1	5.70e-241	1	463	1	464
BBL09117.1	5.70e-241	1	463	1	464
CBK63904.1	1.29e-239	1	463	1	462

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6T2B_A	5.99e-87	40	454	23	439	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]
2IXA_A	9.39e-60	59	454	21	432	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
3EC7_A	1.32e-14	58	216	23	176	CrystalStructure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_B Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_C Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_D Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_E Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_F Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_G Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_H Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
3E18_A	8.09e-11	64	276	11	197	CRYSTALSTRUCTURE OF NAD-BINDING PROTEIN FROM Listeria innocua [Listeria innocua],3E18_B CRYSTAL STRUCTURE OF NAD-BINDING PROTEIN FROM Listeria innocua [Listeria innocua]
1EVJ_A	4.39e-10	113	418	57	343	ChainA, GLUCOSE-FRUCTOSE OXIDOREDUCTASE [Zymomonas mobilis],1EVJ_B Chain B, GLUCOSE-FRUCTOSE OXIDOREDUCTASE [Zymomonas mobilis],1EVJ_C Chain C, GLUCOSE-FRUCTOSE OXIDOREDUCTASE [Zymomonas mobilis],1EVJ_D Chain D, GLUCOSE-FRUCTOSE OXIDOREDUCTASE [Zymomonas mobilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0C863	4.73e-212	39	462	34	461	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides fragilis (strain YCH46) OX=295405 GN=BF0931 PE=3 SV=1
Q5LGZ0	4.73e-212	39	462	34	461	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / NCTC 9343 / Onslow) OX=272559 GN=BF0853 PE=1 SV=1
Q89ZX8	1.42e-209	34	462	32	464	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4243 PE=3 SV=1
A6KX96	7.69e-208	39	462	39	468	Glycosyl hydrolase family 109 protein 1 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0340 PE=3 SV=1
Q7MWF4	7.99e-207	1	463	7	466	Glycosyl hydrolase family 109 protein OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) OX=242619 GN=PG_0664 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000350	0.231378	0.768004	0.000090	0.000103	0.000094

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001657_01732.