CAZyme Information: MGYG000001658_00815

Basic Information

• Species: SFFH01 sp900548125
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-74; SFFH01; SFFH01 sp900548125
• CAZyme ID: MGYG000001658_00815
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
284	MGYG000001658_21|CGC1	32014.84	5.0668

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001658	2715075	MAG	United States	North America

• Gene Location: Start: 2054; End: 2908 Strand: +

Full Sequence      

MSENTPMRRRRPPQPVQIDDASIPHKSDEDNPVRPAREMPPHRRVRVVPIETTDDDAPRH
LPESPLSSLPTPVRFGALALALILLIVGSVSITRTYLAHQEERRRLEAEAAERAQHPLYY
ADTITAYADAQELDPALVAAVILCESSYDPKAESRLGARGLMQLMPDTAEWVAHKLGEDG
ADYSFDNLYDPQTNIRFGTWYLGYLSRRFNGDATKIVCAYHAGQGNVDSWLKNPQYSSDG
VTLDVIPTQDTATYASRVLRARDIYRKYYFPIELPDTQQTETES

Enzyme Prediction     

No EC number prediction in MGYG000001658_00815.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	133	262	8.9e-28	0.7925925925925926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	1.35e-72	117	264	1	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	7.06e-48	117	267	3	151	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	9.44e-37	135	261	1	109	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	2.36e-34	98	269	117	287	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
pfam01464	SLT	1.75e-30	124	235	1	107	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUA53916.1	6.34e-54	69	270	259	460
QUC68078.1	6.89e-50	56	270	236	452
QTE71168.1	2.76e-49	39	270	215	454
QTE75132.1	2.76e-49	39	270	215	454
QTE68505.1	2.91e-46	69	270	248	451

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QSA_A	1.58e-20	117	269	450	601	CrystalStructure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.65 Angstroms Resolution [Escherichia coli],1QTE_A Crystal Structure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.90 A Resolution In Complex With A 1,6- Anhydromurotripeptide [Escherichia coli]
1SLY_A	2.14e-20	117	269	450	601	ComplexOf The 70-Kda Soluble Lytic Transglycosylase With Bulgecin A [Escherichia coli]
5MPQ_A	5.64e-19	106	279	394	569	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	5.66e-19	106	279	398	573	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	5.70e-19	106	279	404	579	Lytictransglycosylase in action [Neisseria meningitidis MC58]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AGC3	8.86e-20	117	269	477	628	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P0AGC4	8.86e-20	117	269	477	628	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
P39434	5.99e-18	117	269	477	628	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
O64046	1.28e-15	120	259	1422	1538	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
O31976	1.28e-15	120	259	1422	1538	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000016	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
75	97