CAZyme Information: MGYG000001659_00353

Basic Information

• Species: Paraprevotella sp900760455
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Paraprevotella; Paraprevotella sp900760455
• CAZyme ID: MGYG000001659_00353
• CAZy Family: GH29
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
491		54253.92	4.8278

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001659	3410285	MAG	United States	North America

• Gene Location: Start: 3399; End: 4874 Strand: -

Full Sequence      

MVAFGIIGTPTLVSAQSEFKLESQSLSNPDNEPAPVHPVPHERQVKWNETEFYAFYHYGM
NTYTGREWGNGDEPESGFAPTAAPNPRQWLEAAKAAGMKGGIAVVKHHDGFCLWPTASTT
HNITNGGNDFARQTNIPRDFAQAARELDMKYGFYVSPWDRNSAHYGKDTYVKEVFLRQCA
ELAQYGTDQFEMWFDGANGGSGYYGGEGGTRSIDADTYYDIPNLRDSVHKVCPDCVMWGV
GGEARWIGNEAGWAGETCWSMGEGTSGNENEWKWDAGESDAKATSAGWFWHSGETVKTAE
RLFQMYLETVGRNATLILNLPPDQSGSLPEATVTRMQELGTLLQNRLSNDLAPNATVTAS
EERTSGASRTYAAANVIDNDKDTYWATNDGTIEASLTFEWPAEQTIRYVSMMEYIRKGQR
VKGFKIETSTDGNSWTTQGGNIQTTTIGYKRIIPLNGSTSASYGTGVRAKYLRITIEDSK
ACPLLHTVSIY

Enzyme Prediction     

EC	3.2.1.111	3.2.1.51

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	27	344	3.9e-59	0.9075144508670521
CBM32	358	478	3.2e-18	0.8548387096774194

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3669	AfuC	5.18e-38	33	491	4	430	Alpha-L-fucosidase [Carbohydrate transport and metabolism].
pfam01120	Alpha_L_fucos	2.83e-23	78	344	75	329	Alpha-L-fucosidase.
smart00812	Alpha_L_fucos	2.16e-22	29	340	9	327	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.
pfam00754	F5_F8_type_C	4.76e-12	356	476	1	112	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFQ12303.1	2.15e-240	1	491	7	492
QFQ12382.1	8.73e-240	3	491	9	492
QFQ13684.1	2.35e-239	23	491	29	500
AUI56213.1	4.56e-220	21	491	31	509
QUB82373.1	1.85e-219	21	491	31	509

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5K9H_A	2.10e-77	35	491	34	463	Crystalstructure of a glycoside hydrolase 29 family member from an unknown rumen bacterium [unidentified]
3UES_A	2.00e-67	40	485	19	470	Crystalstructure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3UES_B Crystal structure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]
4ZRX_A	5.92e-67	39	491	31	458	Crystalstructure of a putative alpha-L-fucosidase (BACOVA_04357) from Bacteroides ovatus ATCC 8483 at 1.59 A resolution [Bacteroides ovatus ATCC 8483]
3UET_A	2.24e-65	40	485	19	470	Crystalstructure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis D172A/E217A mutant complexed with lacto-N-fucopentaose II [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3UET_B Crystal structure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis D172A/E217A mutant complexed with lacto-N-fucopentaose II [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]
3EYP_A	2.52e-65	34	491	4	454	Crystalstructure of putative alpha-L-fucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],3EYP_B Crystal structure of putative alpha-L-fucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],4OUE_A Crystal structure of an a-L-Fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with IPTG [Bacteroides thetaiotaomicron VPI-5482],4OUE_B Crystal structure of an a-L-Fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with IPTG [Bacteroides thetaiotaomicron VPI-5482],4OZO_A Crystal structure of an a-L-fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with oNPTG [Bacteroides thetaiotaomicron VPI-5482],4OZO_B Crystal structure of an a-L-fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with oNPTG [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7XUR3	2.74e-72	29	491	29	476	Putative alpha-L-fucosidase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os04g0560400 PE=3 SV=2
Q8GW72	4.13e-72	23	491	23	477	Alpha-L-fucosidase 1 OS=Arabidopsis thaliana OX=3702 GN=FUC1 PE=1 SV=2
Q6AYS4	8.08e-07	85	344	105	353	Plasma alpha-L-fucosidase OS=Rattus norvegicus OX=10116 GN=Fuca2 PE=2 SV=1
P49713	4.49e-06	85	340	98	339	Putative alpha-L-fucosidase OS=Caenorhabditis elegans OX=6239 GN=W03G11.3 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.682184	0.316389	0.000724	0.000390	0.000146	0.000147

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001659_00353.