CAZyme Information: MGYG000001659_00386

Basic Information

• Species: Paraprevotella sp900760455
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Paraprevotella; Paraprevotella sp900760455
• CAZyme ID: MGYG000001659_00386
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
340		38180.69	7.9864

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001659	3410285	MAG	United States	North America

• Gene Location: Start: 40041; End: 41063 Strand: -

Full Sequence      

MTYEILIRTLNKLLKTVCCLVIAEAWADVTCVNAQSSADIDAYISQYKQIALEQEKQYGI
PASITLAQGILESGAGKSMLTQHTNNHFGIKALGGWTGPIYRAWDDESQKSRFRKYASAN
DSYLDHARLLKNNSRYRNLFSNSVYDYRAWAIGLQKAGYATARHYAKALIGFIDAYKLYA
INGGVKLKAGKTVVITKQTSTTQPLFDSDCIMDDAEESEEETELTNITKKFVVDINNVRC
TVLYPGENIASIALKYDIPQAKILKYNELSDPAEIKEGDIVYLEKKKKKFSGLLDKYIVK
ANETLYGISQKFGIQMASLAKMNDIDIFFKLKEGDTLDLQ

Enzyme Prediction     

No EC number prediction in MGYG000001659_00386.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	49	178	1.5e-34	0.9765625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	2.01e-33	36	180	39	186	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
NF038016	sporang_Gsm	1.91e-32	41	179	161	309	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
pfam01832	Glucosaminidase	8.44e-25	48	126	1	77	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
PRK12709	flgJ	1.26e-23	36	170	169	313	flagellar rod assembly protein/muramidase FlgJ; Provisional
PRK05684	flgJ	2.52e-23	37	177	149	298	flagellar assembly peptidoglycan hydrolase FlgJ.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFQ11765.1	5.00e-61	21	340	8	323
BAV94377.1	9.04e-60	34	337	20	308
QEW37663.1	2.31e-58	32	323	21	279
QQY37845.1	2.38e-58	32	323	22	280
QQY41126.1	2.38e-58	32	323	22	280

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DN5_A	2.02e-14	37	177	3	149	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	2.78e-14	37	177	3	149	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
3VWO_A	5.99e-12	51	178	12	148	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	7.15e-12	51	178	13	149	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
5T1Q_A	1.81e-08	33	178	53	208	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P58231	2.81e-14	39	177	148	295	Peptidoglycan hydrolase FlgJ OS=Escherichia coli O157:H7 OX=83334 GN=flgJ PE=3 SV=1
P75942	2.81e-14	39	177	148	295	Peptidoglycan hydrolase FlgJ OS=Escherichia coli (strain K12) OX=83333 GN=flgJ PE=3 SV=1
P15931	4.42e-13	33	177	145	298	Peptidoglycan hydrolase FlgJ OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=flgJ PE=1 SV=1
Q9KQ15	1.68e-12	42	185	163	318	Peptidoglycan hydrolase FlgJ OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=flgJ PE=3 SV=2
Q9I4P4	3.29e-11	38	167	237	376	Peptidoglycan hydrolase FlgJ OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=flgJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.048033	0.749431	0.201608	0.000351	0.000270	0.000272

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001659_00386.