CAZyme Information: MGYG000001659_00819

Basic Information

• Species: Paraprevotella sp900760455
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Paraprevotella; Paraprevotella sp900760455
• CAZyme ID: MGYG000001659_00819
• CAZy Family: CBM13
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
933	MGYG000001659_8|CGC1	103071.41	5.2949

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001659	3410285	MAG	United States	North America

• Gene Location: Start: 29327; End: 32128 Strand: -

Full Sequence      

MKNDLTLLLALVLAGGYAIPANADDSPEAPGSLVAQPVTDRIVPFKLSEPGITRKVEWGA
DAAWMHEQNLRRCVLFMGKDNVSIVRVSFQPTYPLVDGDLQQPQKDDLKERLRLLGFTAP
DVKLTLNCDHPSVDNWYRTNAENCAQLIDVTARYFQEAGYEIVAVSPFNEPDYGWNQWTP
GSQDAWESLRMSGFKQIVEKLRENSRFDNIRICGGNTLNCDRALPWYNYLKENLDEGNTH
QLAGSFNSFANFYTTLKEDGKHATADEMHNVMEAMVGLEYGLQTGIWWGPAEYARGEFCK
ASHGERLAYAEHRDNWTAASVYRAPDGKVQAFGGTSERQGATTTYRFVSKDRDVFYNGHG
PQREFVMELPGGTGYQSGQTNAEQVVNITWGEDVQPIVDGTYYLFNKSLSTRILEAGNSN
NCFMGTYSSNSTIRWNVNPVDPRIGGDFSYHYITSAANNQSLDVLNWSLDDKAEVILYTK
NNNANQQWYLEYAGDNWFYVRNRHSSLCLEVENNALKQGTPDGSAKQLWRFIPLGTRPRI
TTPATVTGVAAQAGASSIRLTWNPAEAKGTTFTVLRSETSGGGYDLIARQLQDTTFTDNK
VAAGQRYHYVVKATDRHLNTSAASAEVSAVATGANDLVAHYEFEENTKDTTVNQNHGATL
AAPSFAEGKTGKHAIALNGTTDFVQLPAEIANRQRMTVAAWVNWKGGNAWQRIFDFGNGE
DEYIFLTPNAGSQRLRLAIKGNGGGEQYIDSRVSLAGKLNTWIHVAATWDENGVNLYQDG
ELVASSTDMTLRPCDFKPVMNYIGRSQFGADPMFRGSIDDVRIYNFAMNAQQISDLANGN
ESGNSISTATQDNNSLHVGGLPANHAVEVSYGTAGEAQVDFCIYDTQGRTVLTARARQSE
HVSIGVSALPDGVYILKAVCGKESCSKKFTVQH

Enzyme Prediction     

No EC number prediction in MGYG000001659_00819.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM13	399	532	1.3e-17	0.6914893617021277

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13385	Laminin_G_3	2.07e-35	678	834	1	151	Concanavalin A-like lectin/glucanases superfamily. This domain belongs to the Concanavalin A-like lectin/glucanases superfamily.
pfam14200	RicinB_lectin_2	1.92e-14	434	521	4	85	Ricin-type beta-trefoil lectin domain-like.
pfam14200	RicinB_lectin_2	2.31e-09	484	535	1	58	Ricin-type beta-trefoil lectin domain-like.
pfam00652	Ricin_B_lectin	4.72e-08	452	537	4	90	Ricin-type beta-trefoil lectin domain.
cd00161	RICIN	1.05e-07	402	531	1	124	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT88791.1	0.0	2	933	12	940
ALJ60208.1	0.0	2	933	12	940
ASB47762.1	2.11e-294	25	932	31	932
APZ45922.1	2.14e-238	7	933	12	930
AUC19784.1	2.14e-238	7	933	12	930

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HON_A	1.14e-12	637	841	5	209	Structureof Domain 4 of AbnA, a GH43 extracellular arabinanase from Geobacillus stearothermophilus, in complex with arabinotriose [Geobacillus stearothermophilus],5HON_B Structure of Domain 4 of AbnA, a GH43 extracellular arabinanase from Geobacillus stearothermophilus, in complex with arabinotriose [Geobacillus stearothermophilus]
5HO0_A	2.17e-11	637	841	644	848	Crystalstructure of AbnA (closed conformation), a GH43 extracellular arabinanase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5HO2_A Crystal structure of AbnA (open conformation), a GH43 extracellular arabinanase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5HOF_A Crystal structure of AbnA, a GH43 extracellular arabinanase from Geobacillus stearothermophilus, in complex with arabinopentaose [Geobacillus stearothermophilus],5HP6_A Structure of AbnA, a GH43 extracellular arabinanase from Geobacillus stearothermophilus (a new conformational state) [Geobacillus stearothermophilus]
5G56_A	6.51e-11	366	620	434	695	ChainA, Carbohydrate Binding Family 6 [Acetivibrio thermocellus]
3MPC_A	3.31e-08	540	620	2	83	ChainA, Fn3-like protein [Acetivibrio thermocellus ATCC 27405],3MPC_B Chain B, Fn3-like protein [Acetivibrio thermocellus ATCC 27405]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P16950	8.48e-07	536	629	922	1014	Amylopullulanase OS=Thermoanaerobacter thermohydrosulfuricus OX=1516 GN=apu PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000400	0.998684	0.000237	0.000265	0.000211	0.000177

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001659_00819.