CAZyme Information: MGYG000001659_01292

Basic Information

• Species: Paraprevotella sp900760455
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Paraprevotella; Paraprevotella sp900760455
• CAZyme ID: MGYG000001659_01292
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1286	MGYG000001659_18|CGC1	147559.9	5.269

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001659	3410285	MAG	United States	North America

• Gene Location: Start: 3735; End: 7595 Strand: +

Full Sequence      

MKQLIDCFIPYIDRNQVRPTQDALRTETSVNDIFWLNLAGSTDNTGDGAKMLATDNLWST
GTLRLIAEAATAPYCLFYTKTTPLQLGYHALERLTQIAGDSQAPFVYADHYVLCEGRLVP
HPVIDYQYGSLRDDFDFGSVLFLRTECLKSYFKQTDQPDYRYAGWYDVSLYLSRIATPFH
LNEYLYTEEELDTRKSGEKQFDYVNPRNREVQIEMEAACTEHLKAIGAWLAPDEFDEIAF
DRETFPYEASVIIPVRNRVRTIGDAINSVLMQETDFPFNLIIVDNGSNDGTTEVIRSFCG
DERIVHIIPERNDLGIGGCWNTAIHHPSCGRFAVQLDSDDLYSSPQTLQRIVNAFYEQHA
AMVIGSYRMTDFNLQTLPPGLIDHKEWTPENGRNNALRINGLGAPRAFYTPVLRKWQIPN
TSYGEDYALGLCLSRRFRIGRIYDELYLCRRWDGNSDAALSIDKINLNNLYKDRLRTLEV
LARQALNTRWQHTLQENEAKEFFQRQLATWDEARERYEALAQAQIREWPVGDSVIQAQYN
PARIVSTGAKIDKDSIKERPCFLCDHNRPEEQDCLPTEMYYQLLVNPFPILPEHFTIPLR
RHKPQAIKEHFNTLRQMAWHMPEYLVFYNGPSCGASAPDHMHLQAGSRGVLPIERDWRLY
ENTMEKLYPLSPEQEAVVEDAGHSATHCGLYLLTGYVCLVFVIRSYPSEKECMLFRKLYD
ALPCPKGEPEPLMNILCWRQNGSGGREDELITLIFPRKKHRPDCYTAEGEEQMLVSPGAI
DMGGLIITPCEKDFRRMTAEKAIAILQEVTLSPEELAPVLRTVKEEKNAKAEKTEARTKE
NDWQKEPIVNVGIMSGTELYFSLNTNYSAKGETVRGDQTVEYREGGILWNGNIYRELTFI
PQEKKASFSLYNVTIGIRFHWERQETQIFSGTLKLIVEEEKITAINLLPAEDYLISVISS
EMSAACSLEFLKASAVISRSWLYAQMKKRESMEKHSGSFFSFIKTDTESIRWYDREDHTL
FDVCADDHCQRYQGITRAWNEKVIEAVRATRGQILMSGEDICDTRFSKCCGGITEEFEYC
WEDTHKPYLQSIRDWNPEKTDSIVPAQPDLSLEAEAEAWIRSNPPSFCNTHDPEILKQVL
NDYDRETTDFYRWRVEYTQEEISSLINENLKGEYGDIVDLIPVERGHGGHISKLKIVGTQ
HTITIGKELEIRRTLSSTHLFSSAFTVDKLDVKDGIPGRFVLTGAGWGHGVGMCQIGAAV
MGSRGYTYDAILHHYYKHTCLKKLYR

Enzyme Prediction     

No EC number prediction in MGYG000001659_01292.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	250	380	2.2e-21	0.7529411764705882

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam16269	DUF4922	8.38e-99	610	817	1	188	Domain of unknown function (DUF4922). This family consists of uncharacterized proteins around 310 residues in length and is mainly found in various Bacteroides and Parabacteroides species. Several members are annotated as putative glycosyltransferases, but the specific function of this family is still unknown.
TIGR02669	SpoIID_LytB	1.64e-44	943	1283	1	267	SpoIID/LytB domain. This model describes a domain found typically in two or three proteins per genome in Cyanobacteria and Firmicutes, and sporadically in other genomes. One member is SpoIID of Bacillus subtilis. Another in B. subtilis is the C-terminal half of LytB, encoded immediately upstream of an amidase, the autolysin LytC, to which its N-terminus is homologous. Gene neighborhoods are not well conserved for members of this family, as many, such as SpoIID, are monocistronic. One early modelling-based study suggests a DNA-binding role for SpoIID, but the function of this domain is unknown. [Unknown function, General]
COG2385	SpoIID	7.08e-34	883	1284	88	393	Peptidoglycan hydrolase (amidase) enhancer domain [Cell wall/membrane/envelope biogenesis].
TIGR02870	spore_II_D	4.02e-32	939	1284	66	338	stage II sporulation protein D. Stage II sporulation protein D (SpoIID) is a protein of the endospore formation program in a number of lineages in the Firmicutes (low-GC Gram-positive bacteria). It is expressed in the mother cell compartment, under control of Sigma-E. SpoIID, along with SpoIIM and SpoIIP, is one of three major proteins involved in engulfment of the forespore by the mother cell. [Cellular processes, Sporulation and germination]
pfam08486	SpoIID	4.96e-31	938	1056	1	100	Stage II sporulation protein. This domain is found in the stage II sporulation protein SpoIID. SpoIID is necessary for membrane migration as well as for some of the earlier steps in engulfment during bacterial endospore formation. The domain is also found in amidase enhancer proteins. Amidases, like SpoIID, are cell wall hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFQ11638.1	0.0	25	1286	9	1262
QNT65264.1	0.0	1	1286	1	1260
BCS84357.1	0.0	1	1286	1	1253
QUB57862.1	0.0	2	1286	4	1249
QUB56535.1	0.0	2	1286	4	1249

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q02113	8.76e-08	957	1281	425	702	Amidase enhancer OS=Bacillus subtilis (strain 168) OX=224308 GN=lytB PE=1 SV=1
P07372	1.65e-07	948	1279	75	327	Stage II sporulation protein D OS=Bacillus subtilis (strain 168) OX=224308 GN=spoIID PE=4 SV=1
Q9LM93	4.23e-07	247	366	13	132	Dolichol-phosphate mannosyltransferase subunit 1 OS=Arabidopsis thaliana OX=3702 GN=DPMS1 PE=1 SV=1
C0QYX7	5.78e-07	929	1276	88	346	Uncharacterized protein BHWA1_00569 OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) OX=565034 GN=BHWA1_00569 PE=1 SV=1
P13251	9.11e-07	948	1277	76	326	Stage II sporulation protein D OS=Bacillus amyloliquefaciens OX=1390 GN=spoIID PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001659_01292.