CAZyme Information: MGYG000001659_02325

Basic Information

• Species: Paraprevotella sp900760455
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Paraprevotella; Paraprevotella sp900760455
• CAZyme ID: MGYG000001659_02325
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1468		163425.5	4.837

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001659	3410285	MAG	United States	North America

• Gene Location: Start: 20531; End: 24937 Strand: +

Full Sequence      

MKHSLLIATLLLNAWTAQAAFRVTGMKVSGQSAPVGIDLPKPTFSWQTESDERGFRQSGY
QVVVTDENGTEVWNSGRVASAKQNNIAYDGTALQSRTRYTWKVTVSGEGTGEETAESSFE
TAFMNPDEWTARWIEADIAEPTGAVVIDFPEKVNCRYVKLDVTRLGIPASNDPNYYFLQL
AEMEIISGGENVARSATFTASESWEDYAQWNLRYLNDGIVRGDNSRMGYTSRQKANADQH
IYITADLHTAQDVERIILYPRQDASAKTDSKRAANFPASYTIQTSNDGNAYAVQHRVTNG
EMPEFAAAAAGTIPYFGRSFTLPAGKTVARARIYASALGVFTMKLNGQNVTENRLEPGES
EFGRSVLYSTYDVTSLLRTGRNALLARVAGGLFNVTPVAGRYSKGEIQNSGNTSLLAELI
VEYTDGTEEHIVTDNEWRCAPSPTTGSNWWGGEDYDARLYDPRTEQADADFTEWKNAREV
TPSFRFGHVNKSFNRPGILKARAYEPLRVVETWQAVGVRRMANGDYMVDFGRNYAGTYRF
HLKGRKGQTIRLREFERLDAAGNGYIDNWYTGTSVVYEEYTFAGDENGESWGPEFMYHGF
RYMQVSGLDEAPSPTDFTAERIRSNMEQTGYFATSNTLLNDIHTLCRDAIQSQLYNTITD
CPQREKLGWLDVPNEMFNSLCYNYDMTTFWSKVVMDCFDAQGDNGFVPSTAPWFMNVYAD
DPNWGGTAILVPWRSLKTYGDRSLMERYYPQMRRLMDYYTTRSTGGIMHNYSVLSDWGQS
SCGLAVQTPTEFTITTTYYCLLRAMAEMATEMGETADAGRYTALADEVKTAFNARFLREG
NVYNNGNQAEYGMALYYGLADGENEAAVAARLAEKVRNDDYRIRTGEIGLKPVLMSLARH
GYNDVVYRMANQTDYPSYGFFVKSGCTTTPEYWDMNRADNSQNHCMMDHIEEWFFSELGG
IRNAGTAFDEIELSPWIPADMHSLDVSSHCVYGTIRSAWRRTTAGGMRYEFTVPANTTAV
IRVPLASGSRSLLEDGRPLEAGERGIDDVSYTDSLAIVRVGSGHYVFTTGNVESDDRAAV
EQLWMPVHQDAQLPAGSHVMIQEAVHSGHSGRFLGWCGNHGRRDGEFVTGAPAAQAVTFT
VEEPENQQTDGRSSFGVLLREAETGLWLNAQNDGGKMLSWNAAGRRWGLDIAEDGRTAIY
RQRDGGRRTANYVFFFDNGANSGVNAFGETAGENLWKVYRRYNVATETSDCLDGAQVNKD
SVFYTRLICRDGRAEGLCLPFDVKAERMPRDFSFWRFASIKSSADKTMRLTALPVDELEA
GQPYLVRYTGGESSATDAEVVFRGLLTTTRPSNNETGVTGCFSSLAPEGRLFVLNAEGNA
FVPAPSDVSPSVFRVYLIADETTERYDIVFGNDTPDDIAAVKSDAPIAEKRTGVYTLDGR
QVARSADDANLAPGLYIIAGKTICKTRR

Enzyme Prediction     

No EC number prediction in MGYG000001659_02325.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	519	1022	1.5e-135	0.9940476190476191
CBM67	309	482	8.8e-31	0.8977272727272727

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	3.61e-80	627	955	1	337	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	4.71e-45	326	511	1	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	9.01e-22	519	622	1	101	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	5.03e-10	960	1031	1	71	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam00754	F5_F8_type_C	3.06e-05	197	291	1	77	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGB27775.1	0.0	7	1068	1	1049
QKW37237.1	2.94e-193	22	1067	43	1059
QKG20444.1	2.12e-188	24	1067	37	1050
QKG20448.1	8.37e-183	19	1068	32	1068
BBA95245.1	5.61e-176	25	1068	68	1118

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W5M_A	8.31e-112	19	1068	2	1029	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6I60_A	1.08e-93	26	1067	35	939	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
6GSZ_A	3.16e-71	331	1030	147	853	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q82PP4	3.52e-111	19	1068	2	1029	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KPL4	3.90e-76	1	1065	1	945	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
T2KNB2	1.50e-71	328	1043	187	897	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	6.55e-69	326	1019	181	874	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000354	0.998744	0.000274	0.000220	0.000190	0.000178

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001659_02325.