CAZyme Information: MGYG000001661_00467

Basic Information

• Species: Bacteroides gallinarum
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides gallinarum
• CAZyme ID: MGYG000001661_00467
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
306	MGYG000001661_3|CGC2	35804.22	10.2936

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001661	3951783	MAG	United States	North America

• Gene Location: Start: 66556; End: 67476 Strand: -

Full Sequence      

MKPIFRLTAIIALLLVSVTVQAQRRNSRYNEYIKRYAPLAVEQMKEYKIPASITLAQGLL
ESGAGQSTLARKSNNHFGIKCHSDWRGRRVYHDDDAKGECFRAYRHPKDSYEDHSLFLKR
GARYAFLFKLKITDYKGWARGLKKAGYATDPSYANRLITIIEDYDLYKYDNRGLSKREAR
RLERELKKKPWLANPHQVYIANDIAYVVARDGDTFRLLGKEFDISWRKLVKYNDLHKEYT
LEAGDIIYLKGKHKKAAKPHTVYIVKDGDSMHSISQKYGIRLKNLYKMNRKDAEYVPEVG
DRLRLR

Enzyme Prediction     

No EC number prediction in MGYG000001661_00467.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	37	166	2.7e-37	0.984375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
NF038016	sporang_Gsm	4.89e-45	32	170	163	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
COG1705	FlgJ	5.81e-40	8	171	11	189	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
smart00047	LYZ2	7.51e-29	31	170	10	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
pfam01832	Glucosaminidase	8.09e-28	37	166	1	91	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
TIGR02541	flagell_FlgJ	2.09e-26	33	161	155	290	flagellar rod assembly protein/muramidase FlgJ. The N-terminal region of this protein acts directly in flagellar rod assembly. The C-terminal region is a flagellum-specific muramidase (peptidoglycan hydrolase) required for formation of the outer membrane L ring.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRQ47886.1	4.33e-207	1	306	1	306
QUT47310.1	8.74e-207	1	306	1	306
QMI81840.1	3.78e-199	1	306	1	307
QPH57455.1	4.41e-198	1	306	1	307
QBJ17132.1	7.29e-197	1	306	1	307

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VWO_A	5.04e-13	38	161	10	143	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	6.04e-13	38	161	11	144	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
3K3T_A	4.04e-12	38	161	11	144	E185Amutant of peptidoglycan hydrolase from Sphingomonas sp. A1 [Sphingomonas sp. A1]
5T1Q_A	1.28e-10	31	171	62	213	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
5DN5_A	2.73e-10	37	162	14	146	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	1.11e-15	45	170	64	198	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
P37710	8.97e-15	30	289	181	457	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2
Q9X9J3	8.38e-14	32	160	163	301	Peptidoglycan hydrolase FlgJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=flgJ PE=3 SV=1
Q9KQ15	3.93e-12	20	168	153	313	Peptidoglycan hydrolase FlgJ OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=flgJ PE=3 SV=2
Q2G222	1.05e-09	31	171	322	473	N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=SAOUHSC_02979 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000253	0.999055	0.000194	0.000152	0.000155	0.000144

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001661_00467.