CAZyme Information: MGYG000001661_00478

Basic Information

• Species: Bacteroides gallinarum
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides gallinarum
• CAZyme ID: MGYG000001661_00478
• CAZy Family: PL1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
461	MGYG000001661_3|CGC3	50406.35	4.5511

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001661	3951783	MAG	United States	North America

• Gene Location: Start: 79589; End: 80974 Strand: -

Full Sequence      

MNLIGLFCLAWALLSCSHEEENGSPAATFPDYGEVLAFPGAEGYGRHATGGRTGEVYQVT
TLADSGKGSLRDAVSKPNRIIVFKVAGIIRLESPLDFSKNLTIAAQTAPGDGVVVYGNRV
SFSGADNLICRYLRVRMGMNGREGKDAAGIAYGSDMIFDHMSVTWGRDECFSINGDPKKP
ADQPRNITIQNSFIGQGLQPHSCGGLIQTTVNDGVTLYRNLYIDNKTRNPKVKGLNQFVN
NVLYNWGNGGAYIMGDTQQKSDADIRNNYFIVGTTDNYDGKKLGATAPFTRYNQNFSAYL
SGNFYDDNKDGVLNGRELGREDCMKKSVVAGEEVIVAPTFLERPSDVHPEIEELMTAQEA
YEWIVTEGGASLPARDEVDAYLVEELTSLGKKGLIIHTEEDIPMKGPGNIKSAEAPLDTD
NDGMPDEFEDRYGLDKNDPADAMKIASNGYTNIENYIFLIK

Enzyme Prediction     

No EC number prediction in MGYG000001661_00478.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	86	270	2e-52	0.994535519125683

CDD Domains     

MGYG000001661_00478 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT90499.1	4.09e-284	4	460	6	462
ALJ58382.1	1.12e-281	4	460	6	462
QUT89622.1	3.50e-199	6	460	15	481
QNL41166.1	1.88e-170	19	456	53	503
QUT83146.1	2.39e-168	19	456	52	502

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FI2_A	2.26e-09	42	268	46	273	VexL:A periplasmic depolymerase provides new insight into ABC transporter-dependent secretion of bacterial capsular polysaccharides [Achromobacter denitrificans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B8NQQ7	7.32e-133	35	454	20	407	Probable pectate lyase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=plyC PE=3 SV=1
Q2UB83	1.18e-131	35	454	20	407	Probable pectate lyase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=plyC PE=3 SV=1
A1DPF0	1.73e-131	35	454	21	408	Probable pectate lyase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyC PE=3 SV=1
B0XMA2	1.59e-129	35	454	21	408	Probable pectate lyase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyC PE=3 SV=1
Q4WL88	1.59e-129	35	454	21	408	Probable pectate lyase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000163	0.092023	0.907678	0.000041	0.000049	0.000043

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001661_00478.