CAZyme Information: MGYG000001661_00629

Basic Information

• Species: Bacteroides gallinarum
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides gallinarum
• CAZyme ID: MGYG000001661_00629
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
228	MGYG000001661_4|CGC1	26976.64	6.6074

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001661	3951783	MAG	United States	North America

• Gene Location: Start: 20168; End: 20854 Strand: -

Full Sequence      

MPDYKIKLWNTQNFDIESISYVKEAFTHRKWAFAADYIRMYALYTEGGIYLDSDVKVLKR
FDDFLAHSFFSGVEYHPFVIDRDHSLENIDSDGNRITDNYISGIEIQAAIMGAEKGCPFV
KQVLDWYQDKHFIKPDGTLGLDVIAPQIYARIAENYGFRYKDVDQQLRDNIMVYRSEIFA
GNRREVTPASYAIHFCENSWAKRPFRENVMHYWKFFTFWVKNKMFGVL

Enzyme Prediction     

No EC number prediction in MGYG000001661_00629.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	2	66	6.6e-17	0.8111111111111111

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam04488	Gly_transf_sug	2.92e-12	1	70	15	92	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
COG3774	OCH1	2.91e-07	2	67	111	180	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
pfam12919	TcdA_TcdB	4.34e-04	10	54	153	193	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK68805.1	9.33e-131	1	224	31	255
QUR43722.1	9.33e-131	1	224	31	255
QRM97945.1	9.33e-131	1	224	31	255
BBA29457.1	5.45e-94	1	224	31	247
QUB58624.1	7.74e-94	1	207	31	238

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000031	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001661_00629.