CAZyme Information: MGYG000001661_00939

Basic Information

• Species: Bacteroides gallinarum
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides gallinarum
• CAZyme ID: MGYG000001661_00939
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
211		24488.09	9.6368

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001661	3951783	MAG	United States	North America

• Gene Location: Start: 33120; End: 33755 Strand: +

Full Sequence      

MRNTILISLLLMLLPVSVSAQFYTITRYSEILPTERQKESYNRTAKDVTEGKKNKMMVKD
TLTVRSDNLKESEGNSHNSDRKASLNTELQKNVDDITKAENNLPELTIPNLYKEIIRNGI
LYPKIVLAQAILETGWFRSSVCRNKHNLFGLTNPRTGKYYEFNHWTESVRAYYTKVQYKY
KGGNYLLWLDEIGYAEDPYYIKAVIKVIATL

Enzyme Prediction     

No EC number prediction in MGYG000001661_00939.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	112	210	1.4e-17	0.9375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01832	Glucosaminidase	1.16e-15	109	173	2	78	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
smart00047	LYZ2	6.61e-11	121	209	28	137	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
COG1705	FlgJ	8.68e-09	121	211	63	182	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
NF038016	sporang_Gsm	5.53e-07	127	151	186	210	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
PRK08581	PRK08581	5.88e-04	28	163	236	383	amidase domain-containing protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AKA52216.1	1.62e-123	1	211	1	211
QJR77087.1	1.43e-119	1	211	1	211
ALJ41751.1	1.43e-119	1	211	1	211
QUT98797.1	8.20e-117	1	207	1	207
QUT57866.1	7.28e-91	57	211	1	155

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000729	0.998396	0.000258	0.000200	0.000196	0.000202

TMHMM  Annotations     

start	end
5	24