CAZyme Information: MGYG000001661_01284

Basic Information

• Species: Bacteroides gallinarum
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides gallinarum
• CAZyme ID: MGYG000001661_01284
• CAZy Family: GH115
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
862	MGYG000001661_9|CGC1	98789.43	5.8159

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001661	3951783	MAG	United States	North America

• Gene Location: Start: 21356; End: 23944 Strand: +

Full Sequence      

MKMKKSLGILLFSLFCLDAGAIDHKGITSARLAPDRFTLVENGVPDAILIDEQEDAGVMI
AAKNLRSDFKRVTGKAADLQFEPRAKRMIIVGTLHSRYIKELAKAKKIDASLLKSKNEKY
LMTVVSAPLENVDEALVIAGSDKRGTIYGIYELSEQIGVSPWYDWADVPVVPQQNLSIAR
GSYTAGEPAVKYRGIFLNDEAPCLTGWVKHTYGTDYGDHRFYARVFELILRLRGNFMWPA
MWGWSFYADDPENSKTANEMGVIMGTSHHEPMARNHQEWARKRKEYGVWDYASNQEVIDR
FFREGIERAAGTEDLITIGMRGDGDTPMGGKEGEDDKYVPRDEENMRLMEKIFKNQRRII
KEVTGKAPEKRPQVWAIYKEVQRYYDMGLRVPDDVIMLLSDDNWGNVRRLPNAEERKHPG
GWGMYYHVDYVGAPRNTKWLNVTPIQNMWEQLQLTYDYGVDKLWILNVGDLKPMEYPITL
FLDMAWNPKRYTADNLLEHPRGFCAQQFGEEQADEAMRILNLYSKYAGRVTAEMLDSGTY
NLETGEWKQVSDEFIKLEAEALRQYISLEPAYKDAYKQLILFPVQAMANLYEMYYAQAMN
HKFYKENNPQANYWADKVEQAFKRDKDLCHDYNNVMSGGKWKNMMIQKHIGYTSWNDNFP
EDKLPETYRVETPEQAAGGYVFKSRNGVVAMEAEHYFEKKDAAGAQWTVIPYMGRTLSGM
ALMPYSKEVAGASLSYKMEIPEDVTEVTVHVVVKSTLAFHDTKGHEYEVGFTGGDTQTVN
FNANLNEEPENVYSVFYPTVARRVVESQVKLKLPAAGDKLRTLTLKPLDPGIVFEKIVVD
LGGYRKTYLYMDESPCFIPRPE

Enzyme Prediction     

EC	3.2.1.131

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	36	837	5.4e-281	0.9956958393113343

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam15979	Glyco_hydro_115	0.0	186	534	1	334	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
pfam17829	GH115_C	3.78e-34	686	849	6	168	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.
pfam03648	Glyco_hydro_67N	1.28e-04	45	153	21	120	Glycosyl hydrolase family 67 N-terminus. Alpha-glucuronidases, components of an ensemble of enzymes central to the recycling of photosynthetic biomass, remove the alpha-1,2 linked 4-O-methyl glucuronic acid from xylans. This family represents the N-terminal region of alpha-glucuronidase. The N-terminal domain forms a two-layer sandwich, each layer being formed by a beta sheet of five strands. A further two helices form part of the interface with the central, catalytic, module (pfam07488).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EEC54467.1	0.0	1	856	1	856
QRQ48278.1	0.0	1	856	1	856
QUT46101.1	0.0	1	856	1	856
ADD61499.1	0.0	1	856	1	856
ABR37760.1	0.0	1	856	1	856

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C90_A	0.0	10	854	17	849	Evidencethat GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
7PUG_A	0.0	23	855	3	835	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
7PXQ_A	0.0	23	855	2	834	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
4ZMH_A	2.22e-176	18	716	2	672	Crystalstructure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
6NPS_A	1.36e-119	51	665	25	653	Crystalstructure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112],6NPS_B Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000270	0.999015	0.000238	0.000167	0.000149	0.000138

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001661_01284.