CAZyme Information: MGYG000001661_01368

Basic Information

• Species: Bacteroides gallinarum
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides gallinarum
• CAZyme ID: MGYG000001661_01368
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
290		34454.28	8.7274

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001661	3951783	MAG	United States	North America

• Gene Location: Start: 6428; End: 7300 Strand: +

Full Sequence      

MESFKTFRKAPPSQLIMTLLVKNEENMLEENLLFHRAMGVDGFIITDNNSTDSTPDIIRK
YKQKGWIKEVIEEKATDYEQKEWVDRMIWKAKTIYKADWLINADADELWYSPSGNLKTDL
SATRANVLNCEMRSIYPEENKPFWQWDKVVKPVNEPERYDLSTYSIFERQNKKVIHRSAG
YLQISMGNHKVTMFPKLSADSNIRIYHYNIRGKQQFLEKMINGGKQLEQHKGRHGGRHWR
YFYKLYKEGKLESEYDRVIGTSFYRTLCEEQFIIPDTTIPDVFKELNIHQ

Enzyme Prediction     

No EC number prediction in MGYG000001661_01368.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13704	Glyco_tranf_2_4	3.54e-13	22	113	1	89	Glycosyl transferase family 2. Members of this family of prokaryotic proteins include putative glucosyltransferases,
cd02511	Beta4Glucosyltransferase	4.96e-06	19	107	6	82	UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide. UDP-glucose: lipooligosaccharide (LOS) beta-1-4-glucosyltransferase catalyzes the addition of the first residue, glucose, of the lacto-N-neotetrase structure to HepI of the LOS inner core. LOS is the major constituent of the outer leaflet of the outer membrane of gram-positive bacteria. It consists of a short oligosaccharide chain of variable composition (alpha chain) attached to a branched inner core which is lined in turn to lipid A. Beta 1,4 glucosyltransferase is required to attach the alpha chain to the inner core.
pfam00535	Glycos_transf_2	2.46e-04	21	112	6	93	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
pfam01697	Glyco_transf_92	5.56e-04	27	234	19	237	Glycosyltransferase family 92. Members of this family act as galactosyltransferases, belonging to glycosyltransferase family 92. The aligned region contains several conserved cysteine residues and several charged residues that may be catalytic residues. This is supported by the inclusion of this family in the GT-A glycosyl transferase superfamily.
PRK14135	recX	0.006	25	85	96	156	recombination regulator RecX; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRQ49132.1	2.99e-207	2	290	16	304
QUT44871.1	7.38e-193	1	287	1	287
QUT86533.1	1.89e-175	7	287	20	300
ALK83397.1	8.26e-175	7	287	20	300
ABR38758.1	8.26e-175	7	287	20	300

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000077	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001661_01368.