CAZyme Information: MGYG000001661_02535

Basic Information

• Species: Bacteroides gallinarum
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides gallinarum
• CAZyme ID: MGYG000001661_02535
• CAZy Family: GH109
• CAZyme Description: Glycosyl hydrolase family 109 protein 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
516	MGYG000001661_27|CGC1	57635.79	6.2336

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001661	3951783	MAG	United States	North America

• Gene Location: Start: 1546; End: 3096 Strand: -

Full Sequence      

MKGLKALLLSGMCIALCACSSNTSTVQTNDKGTRWQWENGTIVVETPQRPADQKSVIGLA
LPKMEAVRVGFVGLGMRGPGAVERFTHIPGTQVVALCDYERERAEQCQEYLKRASLPKAA
VYSGEKGYEELCKRDDIDLVYIATDWLHHFPVAMCAMENGKNVAIEVPSAMNLKECWALV
DMSEKTRKHCMILENCCYDWFEMNTLNMAQQGVFGEVIRAQGAYIHNLSPFWDHYWKNGE
GDKLGWRLDYNMRHRGDVYATHGLGPVAQALDIHRGDRMQTLVAMDTKSVVGKSLVEART
DSACNNFRNGDHTTTLIRTANGKVIEIQHNVMTPQPYNRLYQLTGSKGFANKYPVEGYAL
DADQLTASGVQPKVDDLNSHGFLPEAEMEALVAKYRHPILKKYGDMAKEVGGHGGMDFIM
DSRLVYCLQNGLPLDMDVYDLAEWCCLAELGELSMDNNCAPVAFPDFTRGEWNVVKGYKH
AYASPEEEAAAMEKAKAFTAKLKEQGAKEWAQVEKK

Enzyme Prediction     

No EC number prediction in MGYG000001661_02535.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	63	473	7e-160	0.9899749373433584

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	7.57e-24	64	396	1	306	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	2.88e-14	67	192	1	118	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
PRK11579	PRK11579	1.44e-04	65	217	3	145	putative oxidoreductase; Provisional
COG4091	COG4091	0.003	67	163	18	129	Predicted homoserine dehydrogenase, contains C-terminal SAF domain [Amino acid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT44459.1	0.0	1	510	1	509
QRQ49631.1	0.0	1	510	1	509
QUT62233.1	0.0	1	512	1	511
QQA30686.1	0.0	1	512	1	511
QUU00485.1	0.0	1	512	1	511

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6T2B_A	1.33e-83	49	472	25	438	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]
2IXA_A	1.62e-67	67	476	21	435	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
3E18_A	5.41e-09	59	246	1	177	CRYSTALSTRUCTURE OF NAD-BINDING PROTEIN FROM Listeria innocua [Listeria innocua],3E18_B CRYSTAL STRUCTURE OF NAD-BINDING PROTEIN FROM Listeria innocua [Listeria innocua]
3E9M_A	1.08e-06	103	305	39	214	CrystalStructure of an oxidoreductase from Enterococcus faecalis [Enterococcus faecalis],3E9M_B Crystal Structure of an oxidoreductase from Enterococcus faecalis [Enterococcus faecalis],3E9M_C Crystal Structure of an oxidoreductase from Enterococcus faecalis [Enterococcus faecalis],3E9M_D Crystal Structure of an oxidoreductase from Enterococcus faecalis [Enterococcus faecalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A6KWM1	0.0	1	511	1	511	Glycosyl hydrolase family 109 protein 4 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0105 PE=3 SV=1
A6L1Z2	0.0	1	516	1	517	Glycosyl hydrolase family 109 protein 5 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_2041 PE=3 SV=1
A6KYY1	3.63e-241	4	504	3	499	Glycosyl hydrolase family 109 protein 3 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0950 PE=3 SV=1
Q89ZX8	1.10e-210	42	483	32	466	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4243 PE=3 SV=1
Q5LGZ0	9.34e-209	42	483	29	463	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / NCTC 9343 / Onslow) OX=272559 GN=BF0853 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000024	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001661_02535.