CAZyme Information: MGYG000001661_02816

Basic Information

• Species: Bacteroides gallinarum
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides gallinarum
• CAZyme ID: MGYG000001661_02816
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
689	MGYG000001661_34|CGC1	79032.11	6.9741

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001661	3951783	MAG	United States	North America

• Gene Location: Start: 11587; End: 13656 Strand: +

Full Sequence      

MGNKILTVFFICVCIFGANIQAMEKEHSPRIIKLLNEKWEYRPISTVGKKALFTPVAIPH
TWNAAPVEGTTLYERKTMVYQRPLEIAEAKEGKRFFLYFEGVNSVAQVFLNRRTVGEHLG
GYTAFCYEITDLVKQGENLLEVWVSNAYRTDVLPISGDFNINGGIHRPCYLIITGEDCIN
PAFYASPGVFIHQDNISDKQADIRVKTLLSVKSKQQDLKLKTTITDAENKVIASNEVPVT
DSIIEQPIRIEHPHLWNGKKNPYLYKVTVELYNGSDLEDRVVQRTGFRYFKVDSDKGFFL
NGEYLNLYGFCRHEDVAGRGSALLLEDYQLDMELIKEAGATAMRLAHYPHAEPMYDLADE
NGIVLWTEIPMCGPGGQAYTGYVGAEGYKNNARQVLKELVYQKFNHPSICFWGICNEILV
NDGKKFIEYDNPIPFIKELNNMYKSLDSSRLTALATCVEQSYYIGTSDLIAWNKYFGWYK
DAAPSVSKFFDDAYKAAKGTPVGVSEYGAGASINQHQWPLRIEDRADSRFHPEEAQTYCH
EGNWEAFAKRPFLWSKFIWVFADFPSYMRMEGEVEGYNDKGLITRDRRIKKDAFYFYKAN
WNPEPMAYITSRRFTQRTNNLTDIKVYTNLKEVTLYLNGVKIGTMAPDEIKRVVWNNVRL
AEGRNVVRIEGKSGKMLVTDDCVWYYFTK

Enzyme Prediction     

No EC number prediction in MGYG000001661_02816.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	24	606	4.5e-89	0.625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10150	PRK10150	1.13e-64	80	605	69	596	beta-D-glucuronidase; Provisional
COG3250	LacZ	6.84e-53	55	616	44	630	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10340	ebgA	3.02e-28	74	417	107	449	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam02836	Glyco_hydro_2_C	2.37e-25	295	602	5	299	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
pfam02837	Glyco_hydro_2_N	7.06e-16	56	174	34	168	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ47728.1	0.0	1	685	1	683
QRQ54627.1	0.0	1	685	1	683
SCV07126.1	0.0	1	685	1	683
QGT72527.1	0.0	1	684	1	681
BCA48702.1	1.32e-296	7	685	5	679

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CMG_A	3.04e-180	34	686	8	655	Crystalstructure of putative beta-galactosidase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]
5Z1A_A	4.62e-180	34	686	27	674	Thecrystal structure of Bacteroides fragilis beta-glucuronidase in complex with uronic isofagomine [Bacteroides fragilis NCTC 9343]
6MVG_A	9.67e-124	25	643	20	620	Crystalstructure of FMN-binding beta-glucuronidase from Ruminococcus gnavus [[Ruminococcus] gnavus],6MVG_B Crystal structure of FMN-binding beta-glucuronidase from Ruminococcus gnavus [[Ruminococcus] gnavus],6MVG_C Crystal structure of FMN-binding beta-glucuronidase from Ruminococcus gnavus [[Ruminococcus] gnavus]
3FN9_A	5.51e-120	30	686	5	665	Crystalstructure of putative beta-galactosidase from bacteroides fragilis [Bacteroides fragilis NCTC 9343],3FN9_B Crystal structure of putative beta-galactosidase from bacteroides fragilis [Bacteroides fragilis NCTC 9343],3FN9_C Crystal structure of putative beta-galactosidase from bacteroides fragilis [Bacteroides fragilis NCTC 9343],3FN9_D Crystal structure of putative beta-galactosidase from bacteroides fragilis [Bacteroides fragilis NCTC 9343]
6MVH_A	2.45e-116	25	649	20	626	Crystalstructure of FMN-binding beta-glucuronidase from Roseburia hominis [Roseburia hominis],6MVH_B Crystal structure of FMN-binding beta-glucuronidase from Roseburia hominis [Roseburia hominis],6MVH_C Crystal structure of FMN-binding beta-glucuronidase from Roseburia hominis [Roseburia hominis],6MVH_D Crystal structure of FMN-binding beta-glucuronidase from Roseburia hominis [Roseburia hominis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPJ7	3.82e-93	5	689	30	724	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
P77989	3.47e-47	53	452	32	412	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
P26257	2.96e-37	35	648	7	597	Beta-galactosidase OS=Thermoanaerobacterium thermosulfurigenes OX=33950 GN=lacZ PE=1 SV=1
T2KN75	4.85e-37	51	671	53	669	Beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22060 PE=1 SV=1
T2KM09	5.16e-37	58	659	80	677	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000183	0.999233	0.000150	0.000147	0.000137	0.000126

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001661_02816.