CAZyme Information: MGYG000001663_00679

Basic Information

• Species: Alistipes sp900760675
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes sp900760675
• CAZyme ID: MGYG000001663_00679
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
410	MGYG000001663_6|CGC2	47190.73	5.6086

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001663	3090424	MAG	United States	North America

• Gene Location: Start: 66541; End: 67773 Strand: -

Full Sequence      

MKKLLISAALGILCTGVSCASRNPLLDSGKPLAVRMVESEIARNPSPMTLDGIPAGKVKW
NYTTGLELLSIMNAGRVYDRPDFYDYAARYFDTIVRPDASVLTYAKSKYNLDHICPGRAL
FEIYDRTHEERYKQVLDTLFEQLHEQPRNADGGFWHKQVYPHQMWLDGLYMAEPFYAEYV
QHYVIHEERPAYYDDIANQFIVVAEHTYDPVTRLYRHAYDDSREMFWCDKTTGQSAHAWG
RAMGWYAMAIVETLQYLSPEDTAGYTEMIKILNHIYEVLPRFADPKTGMWYQVLDEPTRE
GNYLESTGSIMFVYAMLKGVRLGYLPEKYAPEAQKLFEKFVDRFIREDADGTISMTDCCA
VAGLGGKTMRSGTFEYYISEPVIDNDCKGIGPFIWASMEYDHARGKLRKL

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	57	400	5.2e-114	0.963855421686747

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	4.20e-96	33	400	2	339	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	3.54e-84	60	400	34	353	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK63671.1	1.59e-215	1	399	1	395
QUT77882.1	1.25e-132	10	406	12	399
QUT93209.1	2.38e-129	30	401	30	394
QDO69177.1	2.38e-129	30	401	30	394
ALJ61262.1	2.38e-129	30	401	30	394

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	1.28e-100	60	401	23	359	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	3.01e-60	49	401	29	365	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	1.27e-59	49	401	19	355	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3QWT_A	2.92e-12	110	341	108	329	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	7.02e-11	56	341	62	330	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	1.65e-59	49	401	29	365	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	7.08e-34	171	399	1	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	7.08e-34	171	399	1	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1
O31521	2.34e-11	60	354	29	297	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000081	0.034726	0.965156	0.000016	0.000021	0.000017

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001663_00679.