CAZyme Information: MGYG000001663_00769

Basic Information

• Species: Alistipes sp900760675
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes sp900760675
• CAZyme ID: MGYG000001663_00769
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
229		26056.53	6.8585

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001663	3090424	MAG	United States	North America

• Gene Location: Start: 81871; End: 82560 Strand: -

Full Sequence      

MLKKTVLTFAFLSILTTFYGLNADFGSHMTDDILRTAVNENSLLDEGDYVISTYDNIIRN
ISEREGHDWRLMSAIAYHESRFTADITSRSGARGLMQIMPSVARQFEIPAEEVANPETNI
WLANKLMSKIQSSLRFSAGTSEADRMRIVLACYNSGIGHVNDARRLARLNGENPNSWEVV
ARYLQLKAEPEYYENEVVKCGRFTGSRQTLAYVNDVIGRYDKYCRIAMR

Enzyme Prediction     

No EC number prediction in MGYG000001663_00769.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	64	223	9.7e-22	0.837037037037037

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13403	MLTF-like	3.29e-62	63	225	6	161	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG4623	MltF	3.03e-26	31	193	218	404	Membrane-bound lytic murein transglycosylase MltF [Cell wall/membrane/envelope biogenesis, Signal transduction mechanisms].
PRK10859	PRK10859	8.98e-24	24	195	246	425	membrane-bound lytic murein transglycosylase MltF.
pfam01464	SLT	4.67e-19	58	168	1	107	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd16896	LT_Slt70-like	5.15e-17	54	161	4	110	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFL78639.1	3.01e-137	1	229	1	230
BBL08197.1	2.54e-134	1	229	1	232
BBL10988.1	2.54e-134	1	229	1	232
BBL00117.1	2.54e-134	1	229	1	232
CBK65133.1	6.47e-132	1	229	1	230

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5AA4_B	1.34e-17	54	221	252	412	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA4_D Crystal structure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013]
5AA4_A	1.34e-17	54	221	252	412	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA4_C Crystal structure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013]
5AA2_B	1.48e-17	54	221	300	460	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with NAM-pentapeptide. [Pseudomonas aeruginosa BWHPSA013]
5AA2_A	1.48e-17	54	221	300	460	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with NAM-pentapeptide. [Pseudomonas aeruginosa BWHPSA013],5AA2_C Crystal structure of MltF from Pseudomonas aeruginosa in complex with NAM-pentapeptide. [Pseudomonas aeruginosa BWHPSA013]
5AA2_D	1.48e-17	54	221	300	460	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with NAM-pentapeptide. [Pseudomonas aeruginosa BWHPSA013]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q0VRG6	5.51e-19	54	221	288	448	Membrane-bound lytic murein transglycosylase F OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) OX=393595 GN=mltF PE=3 SV=1
B4RVK5	3.48e-18	68	221	306	452	Membrane-bound lytic murein transglycosylase F OS=Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype) OX=1774373 GN=mltF PE=3 SV=3
Q4KHS7	3.70e-18	54	193	289	424	Membrane-bound lytic murein transglycosylase F OS=Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5) OX=220664 GN=mltF PE=3 SV=2
A1U3J1	7.05e-18	54	226	286	451	Membrane-bound lytic murein transglycosylase F OS=Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8) OX=351348 GN=mltF PE=3 SV=1
A5UG36	9.22e-18	48	193	271	422	Membrane-bound lytic murein transglycosylase F OS=Haemophilus influenzae (strain PittGG) OX=374931 GN=mltF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002789	0.995607	0.000884	0.000222	0.000227	0.000234

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001663_00769.