CAZyme Information: MGYG000001663_01208

Basic Information

• Species: Alistipes sp900760675
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes sp900760675
• CAZyme ID: MGYG000001663_01208
• CAZy Family: GH18
• CAZyme Description: Endo-beta-N-acetylglucosaminidase F1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
340	MGYG000001663_14|CGC1	37196.81	4.8186

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001663	3090424	MAG	United States	North America

• Gene Location: Start: 36546; End: 37568 Strand: +

Full Sequence      

MNRNLFTIAAALVMAGAMFTSCAKDVEENQDLTKGTIDETRAYGDKTPIVMAYYEINDTN
PLNALSYTMANGEVFLDIVQLFASNIHKDSNGDPNIYFNDKLAPVMADVAKYVRPIQAAG
IKVLLTVLGDWQGIGVANMTQAQADKFAAILTYIVDTYGLDGIGFDDEYANYPSLNSGSY
ARVIKAVRAKLDAKFPNEHKLITVFQWGNYGQIDAAAGAMIDYADQGSFGANIFPTSSSI
SGMTNDRWMPQAINMGSTYNTINLNYIKNRSGQAKSGNYGGIMMFNIRKHSDRSPLPVYQ
KIAEGAFSSTVTYTGTEYSQDWTFNPNGHTISYADVPAGF

Enzyme Prediction     

No EC number prediction in MGYG000001663_01208.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06542	GH18_EndoS-like	2.28e-28	48	288	1	239	Endo-beta-N-acetylglucosaminidases are bacterial chitinases that hydrolyze the chitin core of various asparagine (N)-linked glycans and glycoproteins. The endo-beta-N-acetylglucosaminidases have a glycosyl hydrolase family 18 (GH18) catalytic domain. Some members also have an additional C-terminal glycosyl hydrolase family 20 (GH20) domain while others have an N-terminal domain of unknown function (pfam08522). Members of this family include endo-beta-N-acetylglucosaminidase S (EndoS) from Streptococcus pyogenes, EndoF1, EndoF2, EndoF3, and EndoH from Flavobacterium meningosepticum, and EndoE from Enterococcus faecalis. EndoS is a secreted endoglycosidase from Streptococcus pyogenes that specifically hydrolyzes the glycan on human IgG between two core N-acetylglucosamine residues. EndoE is a secreted endoglycosidase, encoded by the ndoE gene in Enterococcus faecalis, that hydrolyzes the glycan on human RNase B.
cd00598	GH18_chitinase-like	2.26e-07	50	287	1	207	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.
pfam00704	Glyco_hydro_18	7.44e-07	114	225	57	168	Glycosyl hydrolases family 18.
cd02871	GH18_chitinase_D-like	6.08e-05	89	195	39	145	GH18 domain of Chitinase D (ChiD). ChiD, a chitinase found in Bacillus circulans, hydrolyzes the 1,4-beta-linkages of N-acetylglucosamine in chitin and chitodextrins. The domain architecture of ChiD includes a catalytic glycosyl hydrolase family 18 (GH18) domain, a chitin-binding domain, and a fibronectin type III domain. The chitin-binding and fibronectin type III domains are located either N-terminal or C-terminal to the catalytic domain. This family includes exochitinase Chi36 from Bacillus cereus.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBL01829.1	4.20e-148	18	336	1	321
CBK65022.1	1.77e-88	3	336	2	325
BBL12493.1	1.57e-85	18	336	1	309
BBL09699.1	1.57e-85	18	336	1	309
BBL01454.1	6.61e-80	1	338	1	335

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2EBN_A	3.33e-34	50	322	12	289	CRYSTALSTRUCTURE OF ENDO-BETA-N-ACETYLGLUCOSAMINIDASE F1, AN ALPHA(SLASH)BETA-BARREL ENZYME ADAPTED FOR A COMPLEX SUBSTRATE [Elizabethkingia meningoseptica]
3POH_A	8.14e-28	53	211	173	335	Crystalstructure of an endo-beta-N-acetylglucosaminidase (BT_3987) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.55 A resolution [Bacteroides thetaiotaomicron VPI-5482]
6T8I_A	1.12e-27	53	211	173	335	Crystalstructure of wild type EndoBT-3987 from Bacteroides thetaiotamicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],6T8K_A Crystal structure of Bacteroides thetaiotamicron EndoBT-3987 in complex with Man9GlcNAc product in P1 [Bacteroides thetaiotaomicron VPI-5482],6T8K_B Crystal structure of Bacteroides thetaiotamicron EndoBT-3987 in complex with Man9GlcNAc product in P1 [Bacteroides thetaiotaomicron VPI-5482],6T8L_A Crystal structure of Bacteroides thetaiotamicron EndoBT-3987 with Man9GlcNAc product in P212121 [Bacteroides thetaiotaomicron VPI-5482],6TCW_A Crystal structure of Bacteroides thetaiotamicron EndoBT-3987 with Man5GlcNAc product [Bacteroides thetaiotaomicron VPI-5482],7NWF_A Chain A, Endo-beta-N-acetylglucosaminidase F1 [Bacteroides thetaiotaomicron VPI-5482]
1EDT_A	2.55e-26	48	224	9	191	ChainA, ENDO-BETA-N-ACETYLGLUCOSAMINIDASE H, ENDO H [Streptomyces plicatus]
6VE1_A	3.11e-26	48	224	13	195	ChainA, Endo-beta-N-acetylglucosaminidase H [Streptomyces plicatus],6VE1_B Chain B, Endo-beta-N-acetylglucosaminidase H [Streptomyces plicatus],6VE1_C Chain C, Endo-beta-N-acetylglucosaminidase H [Streptomyces plicatus],6VE1_D Chain D, Endo-beta-N-acetylglucosaminidase H [Streptomyces plicatus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P36911	1.90e-34	18	322	25	339	Endo-beta-N-acetylglucosaminidase F1 OS=Elizabethkingia meningoseptica OX=238 GN=endOF1 PE=1 SV=1
P80036	6.41e-29	48	313	55	313	Endo-beta-N-acetylglucosaminidase OS=Flavobacterium sp. (strain SK1022) OX=148444 PE=1 SV=2
P04067	3.07e-25	48	224	51	233	Endo-beta-N-acetylglucosaminidase H OS=Streptomyces plicatus OX=1922 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000167	0.139803	0.859832	0.000070	0.000074	0.000060

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001663_01208.