CAZyme Information: MGYG000001663_02494

Basic Information

• Species: Alistipes sp900760675
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes sp900760675
• CAZyme ID: MGYG000001663_02494
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
541		59755.97	5.1977

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001663	3090424	MAG	United States	North America

• Gene Location: Start: 11; End: 1636 Strand: +

Full Sequence      

MRGYQGDDLTRKDAVAACLKHFVGYAHSDGGRDYHYTEISQQTLWDTALPPFEMGVKAGA
ATVMSAFNDISGVPASANRYMMTDVLREKWGFGGFVVSDWGAVSQLIPQGVAANDAEACE
KAFMAGLDMDMVDDVYLRELPGLIADGTIPGRALDEAVRRILLVKFRLGLFDDPYIEELP
DQERYLSSGAHAVARELAAESMVLLKNDAQTLPVRSGVKRIALIGPMADNRVDLMGSWWG
QGEADDVVTILEGLKAEFAGKAQIVYHAGCDFDGKDRSQFARALEVARSADLVVLCVGER
RNWSGENASRASLALPAIQEDLVREMARCGRPVVVLVSSGRPVELRNIEPVADAMVAIWQ
PGTEGGCAVAQLLSGKVNPSGRLAITFPLNAEQQPVYYNQRQAARPRSGRYQNLPHAPMY
PFGYGLSYTIYDYGKVHLDKQTLRRGERLVAQIEVTNGGMVDGKETVMWFISDPVASVSR
PVKELKHFEKQFIPAGESRIFRFEIDPVRDLSFPDATGERLLERGEFYLHVNDQKVKFEL
N

Enzyme Prediction     

No EC number prediction in MGYG000001663_02494.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	2	132	1e-38	0.5370370370370371

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	1.24e-171	2	540	190	764	beta-glucosidase BglX.
PLN03080	PLN03080	1.85e-73	2	533	197	770	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	1.04e-67	202	428	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
COG1472	BglX	1.35e-59	2	259	154	388	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	5.29e-39	1	162	157	314	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNA45955.1	2.30e-231	1	540	191	730
QUU00468.1	1.22e-229	1	538	194	732
AGU13705.1	5.65e-228	1	538	194	732
QUT64936.1	5.65e-228	1	538	194	732
QUT62248.1	8.01e-228	1	538	194	732

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XXL_A	2.31e-126	3	537	171	745	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
6R5I_A	8.83e-126	1	531	157	718	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
5XXN_A	1.28e-125	3	537	171	745	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
6R5O_A	4.90e-125	1	531	157	718	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5O_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5R_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5R_A	5.03e-125	1	531	158	719	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56078	3.44e-123	1	540	189	764	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
P33363	8.94e-120	5	540	193	764	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
T2KMH0	2.21e-88	6	531	167	706	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
A7LXU3	3.30e-85	1	534	214	764	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1
T2KMH9	2.16e-80	1	539	210	748	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000005	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001663_02494.