CAZyme Information: MGYG000001664_00327

Basic Information

• Species: CAG-485 sp900760735
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485; CAG-485 sp900760735
• CAZyme ID: MGYG000001664_00327
• CAZy Family: GH5
• CAZyme Description: Endoglucanase Z

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
326	MGYG000001664_5|CGC2	36444.32	5.2275

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001664	3152185	MAG	United States	North America

• Gene Location: Start: 29741; End: 30721 Strand: -

Full Sequence      

MMLMVGSAAVSCNGAKKQADNTEAQDSTFVTPLHVEGLYLLNAKGDTMVLNGPSLGWHSN
WGRFYNDSTVMAFKKNWGANITRAAIGAHTSWDVVNCYDADSIDAMNKLYRVIDAAIAND
MYVIADWHTHKNTLDNAKKFFTAVTEKYGDTPNILYEIWNEPETVKWDEVKAYAEEIIPV
IRKNAPNSVIIVGSPTWDQDVDIASESPLKFDNLLYSLHFYAATHKQPLIDKAEKAIANG
LPLIISECGGMEATGDGPVDEESMRKWVEFADKHKLSMLFWSIADKTETCSMVTPDASDN
GMLWTEEQIKPWGKTAKTIIKKRNHK

Enzyme Prediction     

EC	3.2.1.4	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	44	278	3.8e-86	0.9831223628691983

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	5.88e-55	41	286	1	271	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	2.25e-08	21	234	35	236	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCP72662.1	1.62e-157	4	324	12	333
QCD38972.1	1.62e-157	4	324	12	333
QRX64947.1	3.45e-99	2	322	1	319
AWW31171.1	1.97e-98	1	320	9	319
AXY75874.1	2.53e-98	33	324	28	315

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5IHS_A	8.47e-66	33	324	35	324	Structureof CHU_2103 from Cytophaga hutchinsonii [Cytophaga hutchinsonii ATCC 33406]
1EGZ_A	1.33e-65	30	320	2	284	ChainA, ENDOGLUCANASE Z [Dickeya chrysanthemi],1EGZ_B Chain B, ENDOGLUCANASE Z [Dickeya chrysanthemi],1EGZ_C Chain C, ENDOGLUCANASE Z [Dickeya chrysanthemi]
6GJF_A	5.97e-64	33	322	13	302	Ancestralendocellulase Cel5A [synthetic construct],6GJF_B Ancestral endocellulase Cel5A [synthetic construct],6GJF_C Ancestral endocellulase Cel5A [synthetic construct],6GJF_D Ancestral endocellulase Cel5A [synthetic construct],6GJF_E Ancestral endocellulase Cel5A [synthetic construct],6GJF_F Ancestral endocellulase Cel5A [synthetic construct]
1TVN_A	8.87e-64	30	313	2	292	Cellulasecel5G from Pseudoalteromonas haloplanktis, A family GH 5-2 enzyme [Pseudoalteromonas haloplanktis],1TVN_B Cellulase cel5G from Pseudoalteromonas haloplanktis, A family GH 5-2 enzyme [Pseudoalteromonas haloplanktis],1TVP_A Endoglucanase cel5G from Pseudoalteromonas haloplanktis in complex with cellobiose [Pseudoalteromonas haloplanktis],1TVP_B Endoglucanase cel5G from Pseudoalteromonas haloplanktis in complex with cellobiose [Pseudoalteromonas haloplanktis]
5WH8_A	3.32e-62	33	301	14	291	CellulaseCel5C_n [uncultured organism]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P07103	2.96e-63	30	320	45	327	Endoglucanase Z OS=Dickeya dadantii (strain 3937) OX=198628 GN=celZ PE=1 SV=2
O85465	3.65e-61	21	313	22	319	Endoglucanase 5A OS=Salipaludibacillus agaradhaerens OX=76935 GN=cel5A PE=1 SV=1
P06565	2.53e-60	21	313	22	319	Endoglucanase B OS=Evansella cellulosilytica (strain ATCC 21833 / DSM 2522 / FERM P-1141 / JCM 9156 / N-4) OX=649639 GN=celB PE=3 SV=1
P07983	1.64e-57	33	301	42	311	Endoglucanase OS=Bacillus subtilis OX=1423 GN=bglC PE=3 SV=2
P10475	6.34e-57	33	301	42	311	Endoglucanase OS=Bacillus subtilis (strain 168) OX=224308 GN=eglS PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.774207	0.194723	0.029707	0.000506	0.000309	0.000552

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001664_00327.