CAZyme Information: MGYG000001664_00964

Basic Information

• Species: CAG-485 sp900760735
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485; CAG-485 sp900760735
• CAZyme ID: MGYG000001664_00964
• CAZy Family: GH27
• CAZyme Description: Isomalto-dextranase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
475	MGYG000001664_17|CGC1	53555.43	4.9218

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001664	3152185	MAG	United States	North America

• Gene Location: Start: 14902; End: 16329 Strand: -

Full Sequence      

MAALFCTAMAIAVSCKDKNADAPTPDPTPDPTPELPALPVPGDIHKYKAPLYWTVYEYAR
EMEIAGVPYHEMDLTSDQWDAVIDMMATKFKPYGYDMICTDGFLPQLSRDGSGYMSHYGS
MPLKELVRRAKEKGLKVGVYDNPLWIKGNLDSKVPGTDYTLRSLTRNPQDKVLYPDVTDR
TDFTWVVTDHPGAREYIDGFFKHYHDLGVDFVRMDFMCWYEDGDPGRDEPVTCGYGRERY
ERGLAYICESAAKYGIFTSIVMPELYNDAELESKYCNMTRIVQDANIGGWHHFSSFNRGK
IYDRWPYADNQLDGFTHWSHIGGRGKIILDGDFLRLNKCTTDDERRSQVSLQLIAGGPVA
IADTPETIGNFDKFYTNEELLALNADGFVGKPLSDKIDSEGSCIWYGTMSNGDVVMAMFN
REDSPKKMSVSLADMALSGECKVRDLWRHADEGTVSGSFEATVSRHGCKVVKFTR

Enzyme Prediction     

No EC number prediction in MGYG000001664_00964.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH27	193	452	1.5e-32	0.9388646288209607

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17801	Melibiase_C	8.24e-16	404	473	6	74	Alpha galactosidase C-terminal beta sandwich domain. This domain is found at the C-terminus of alpha galactosidase enzymes.
cd14792	GH27	3.27e-14	81	386	22	271	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
PLN02808	PLN02808	1.11e-13	299	475	207	385	alpha-galactosidase
PLN02229	PLN02229	1.15e-11	301	474	239	418	alpha-galactosidase
PLN02899	PLN02899	1.35e-06	391	470	539	627	alpha-galactosidase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHF13305.1	2.50e-298	37	472	35	470
QNT67171.1	5.60e-184	34	472	33	472
QRM98947.1	8.58e-173	4	475	8	492
QUT44530.1	3.46e-172	4	475	8	492
QUT79686.1	3.46e-172	4	475	8	492

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5AWO_A	2.05e-77	50	474	38	466	Arthrobacterglobiformis T6 isomalto-dextranse [Arthrobacter globiformis],5AWP_A Arthrobacter globiformis T6 isomalto-dextranase complexed with isomaltose [Arthrobacter globiformis],5AWQ_A Arthrobacter globiformis T6 isomalto-dextranse complexed with panose [Arthrobacter globiformis]
4NX0_A	9.66e-14	74	474	39	441	Crystalstructure of Abp-WT, a GH27-b-L-arabinopyranosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4NX0_B Crystal structure of Abp-WT, a GH27-b-L-arabinopyranosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4NX0_C Crystal structure of Abp-WT, a GH27-b-L-arabinopyranosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4NX0_D Crystal structure of Abp-WT, a GH27-b-L-arabinopyranosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4NX0_E Crystal structure of Abp-WT, a GH27-b-L-arabinopyranosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4NX0_F Crystal structure of Abp-WT, a GH27-b-L-arabinopyranosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4NX0_G Crystal structure of Abp-WT, a GH27-b-L-arabinopyranosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4NX0_H Crystal structure of Abp-WT, a GH27-b-L-arabinopyranosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q44052	7.61e-78	50	474	64	492	Isomalto-dextranase OS=Arthrobacter globiformis OX=1665 GN=imd PE=1 SV=1
Q8VXZ7	1.11e-09	330	474	277	428	Alpha-galactosidase 3 OS=Arabidopsis thaliana OX=3702 GN=AGAL3 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.004018	0.026789	0.969046	0.000052	0.000065	0.000047

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001664_00964.