CAZyme Information: MGYG000001664_01706

Basic Information

• Species: CAG-485 sp900760735
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485; CAG-485 sp900760735
• CAZyme ID: MGYG000001664_01706
• CAZy Family: GH32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
509	MGYG000001664_38|CGC1	55868.45	4.6517

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001664	3152185	MAG	United States	North America

• Gene Location: Start: 11155; End: 12684 Strand: +

Full Sequence      

MKSIIFYSLLLASATATLAGCSDDKPVLTDRNLENSTEFLKSNDAAKQDIYYKPAVGFVG
DPMPFYDPVAGDFKILYLQDYRPNQAVTYHPIWGVSTKDAAGYTSLGELIPCGAANELDA
ALGTGSTIYHDGTYYTFYTAHSPNPASTSGINEAVMLATSSDFKSWTKNRTVLVTGGDTY
SNADFRDPFVFRGDDNMFHMLVSTRLNGKGVLAEYTSPDLLEWNDAGVFMTMMWDRFYEC
PDVFRMGDWWYLVYSEQHDAIRRVQYFKGKTLDELKACTANDAGLWPDAHEGYLDSRGFY
AGKTASNGTDRYIWGWNATKAGNVITGNADWAGNLVAHKLIQHPDGTLTVGEVPAIASIL
GNAKTLDGFSLNADESKLMPRLGTENRLTFTITANPGDRFGLSFGRGSDSMSYGTLVFNP
EGDGNMKINLEQEGPEGAGFIQFADSYVFKAPADGVYNITVVTDNSVLTLYINGCLGYTT
RLYGTARNCWSVNCYTGNLAVSEIKVQSK

Enzyme Prediction     

No EC number prediction in MGYG000001664_01706.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH32	52	339	3.6e-42	0.9419795221843004

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd08995	GH32_EcAec43-like	3.09e-113	60	348	1	281	Glycosyl hydrolase family 32, such as the putative glycoside hydrolase Escherichia coli Aec43 (FosGH2). This glycosyl hydrolase family 32 (GH32) subgroup includes Escherichia coli strain BEN2908 putative glycoside hydrolase Aec43 (FosGH2). GH32 enzymes cleave sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose, thus named invertase (EC 3.2.1.26). GH32 family also contains other fructofuranosidases such as inulinase (EC 3.2.1.7), exo-inulinase (EC 3.2.1.80), levanase (EC 3.2.1.65), and transfructosidases such sucrose:sucrose 1-fructosyltransferase (EC 2.4.1.99), fructan:fructan 1-fructosyltransferase (EC 2.4.1.100), sucrose:fructan 6-fructosyltransferase (EC 2.4.1.10), fructan:fructan 6G-fructosyltransferase (EC 2.4.1.243) and levan fructosyltransferases (EC 2.4.1.-). These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. These enzymes are predicted to display a 5-fold beta-propeller fold as found for GH43 and CH68. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize.
pfam16346	DUF4975	4.63e-53	346	506	1	176	Domain of unknown function (DUF4975). This family consists of uncharacterized proteins around 500 residues in length and is mainly found in various Bacteroides species. Several proteins in this family are annotated as Glycosyl hydrolases, but the function of this protein is unknown.
cd08996	GH32_FFase	7.64e-33	124	335	65	273	Glycosyl hydrolase family 32, beta-fructosidases. Glycosyl hydrolase family GH32 cleaves sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose, thus named invertase (EC 3.2.1.26). This family also contains other fructofuranosidases such as inulinase (EC 3.2.1.7), exo-inulinase (EC 3.2.1.80), levanase (EC 3.2.1.65), and transfructosidases such sucrose:sucrose 1-fructosyltransferase (EC 2.4.1.99), fructan:fructan 1-fructosyltransferase (EC 2.4.1.100), sucrose:fructan 6-fructosyltransferase (EC 2.4.1.10), fructan:fructan 6G-fructosyltransferase (EC 2.4.1.243) and levan fructosyltransferases (EC 2.4.1.-). These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. These enzymes are predicted to display a 5-fold beta-propeller fold as found for GH43 and CH68. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
smart00640	Glyco_32	6.06e-27	54	474	4	436	Glycosyl hydrolases family 32.
cd18609	GH32-like	9.97e-27	95	327	48	295	Glycosyl hydrolase family 32 family protein. The GH32 family contains glycosyl hydrolase family GH32 proteins that cleave sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose, thus named invertase (EC 3.2.1.26). This family also contains other fructofuranosidases such as inulinase (EC 3.2.1.7), exo-inulinase (EC 3.2.1.80), levanase (EC 3.2.1.65), and transfructosidases such sucrose:sucrose 1-fructosyltransferase (EC 2.4.1.99), fructan:fructan 1-fructosyltransferase (EC 2.4.1.100), sucrose:fructan 6-fructosyltransferase (EC 2.4.1.10), fructan:fructan 6G-fructosyltransferase (EC 2.4.1.243) and levan fructosyltransferases (EC 2.4.1.-). These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. These enzymes are predicted to display a 5-fold beta-propeller fold as found for GH43 and CH68. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEA21332.1	1.47e-221	1	506	1	528
QUB88319.1	1.47e-221	1	506	1	528
QUB90812.1	2.09e-221	1	506	1	528
QUI94038.1	4.86e-220	1	506	1	528
QUB92624.1	4.86e-220	1	506	1	528

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6R3R_A	8.70e-182	26	508	6	501	Firstcrystal structure of endo-levanase BT1760 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron]
6R3U_A	7.06e-181	26	508	6	501	Endo-levanaseBT1760 mutant E221A from Bacteroides thetaiotaomicron complexed with levantetraose [Bacteroides thetaiotaomicron]
7VCO_A	1.87e-09	124	486	100	461	ChainA, Sucrose-6-phosphate hydrolase [Frischella perrara],7VCP_A Chain A, Sucrose-6-phosphate hydrolase [Frischella perrara]
7BWB_A	1.75e-08	43	359	45	356	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 [Bombyx mori]
7BWC_A	1.64e-07	43	359	45	356	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 mutant D63A in complex with sucrose [Bombyx mori]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40714	1.17e-06	54	407	32	385	Sucrose-6-phosphate hydrolase OS=Escherichia coli OX=562 GN=cscA PE=3 SV=1
P16553	2.70e-06	124	407	98	384	Raffinose invertase OS=Escherichia coli OX=562 GN=rafD PE=3 SV=1
O33833	4.39e-06	47	359	3	301	Beta-fructosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=bfrA PE=1 SV=1
Q01IS8	9.31e-06	3	346	9	370	Beta-fructofuranosidase, insoluble isoenzyme 3 OS=Oryza sativa subsp. indica OX=39946 GN=CIN3 PE=2 SV=2
Q0JDC6	9.31e-06	3	346	9	370	Beta-fructofuranosidase, insoluble isoenzyme 3 OS=Oryza sativa subsp. japonica OX=39947 GN=CIN3 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000055	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001664_01706.