CAZyme Information: MGYG000001665_00036

Basic Information

• Species: UMGS1322 sp900550765
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; QALW01; UMGS1322; UMGS1322 sp900550765
• CAZyme ID: MGYG000001665_00036
• CAZy Family: GH140
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
690	MGYG000001665_1|CGC1	78690.47	5.1275

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001665	2160920	MAG	United States	North America

• Gene Location: Start: 35908; End: 37980 Strand: -

Full Sequence      

MKVKQYRRTDILLTAEKEYENPFLEVNIDAVFTHESGVSISLPGFWKGGKQYCVRFSPTK
IGDWSYTVQSNEPSLCTSGSLTCCANDGITEVDRHGFVTMDAGHRYFFYEDGTPFFWLGD
THWQAPDLERLNECNCPHCSCGSQFKHMVDYRRRQGYNVYQTYPSAADNDGGGGKRCSWW
KEKYTLIDPESFNENFDKKMDYLADSGFVIVMGLGVHSITPEAMGEALCDFAKYMVARYA
AYPVIWITGQEIDMGYVQGKMENYMPYIHAAELTAAYDGYHHPLGTHMLARPYDAPNSAS
PDIDARPWHQFWALQAGHRNELSKGSMRPKSKYYDYYKGGKPFVETEAFYEDLRRCIGGT
TKNLTYSNGYEEVRNAAWKAVLCGSYGFTYGAHGIWGMRWSKDPSDGGWPSTYNAEPWFM
GLYKPAGQEMRFVKDFFEAVDFTRLVPVFYDTQYGEFSSRENAVLATDGNSTYVLYLYGR
EGIAGRLKQLDGNKIYHAWWFDVRTGAYIDAGTMQGKPEYEIPVRPDKNDWTLLVTDREF
VPSRLEVLAKPVSLETIEGQELTFSASTVFTDDTTAEEALSRGQLWRPFCPAASNIIEID
LGQEVSLCCIKLDFEQNTNGLYAYRVDGIREGAMHILCDRIAEPSDKPVNIEKLQGTFRY
LRLNMFSDEGYLDEEKRIVPGICRLQIFGK

Enzyme Prediction     

No EC number prediction in MGYG000001665_00036.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH140	99	532	3.1e-60	0.9878640776699029

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13204	DUF4038	3.94e-49	103	438	1	318	Protein of unknown function (DUF4038). A family of putative cellulases.
pfam16586	DUF5060	6.36e-22	2	71	1	70	Domain of unknown function (DUF5060). This is the N-terminal domain of a putative glycoside hydrolase, DUF4038. It is found in a number of different bacterial orders.
pfam12904	Collagen_bind_2	6.84e-06	455	536	9	92	Putative collagen-binding domain of a collagenase. This domain is likely to be the collagen-binding domain of a family of bacterial collagenase enzymes. It is the C-terminal part of the Structure 3kzs (information derived from TOPSAN).
pfam06119	NIDO	0.002	463	483	6	26	Nidogen-like. This is a nidogen-like domain (NIDO) domain and is an extracellular domain found in nidogen and hypothetical proteins of unknown function.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTH41603.1	7.02e-92	4	663	41	681
QTH45264.1	1.11e-86	1	595	38	608
QJD82871.1	4.20e-84	1	535	38	567
BBI36498.1	5.81e-80	3	535	38	566
BBH22106.1	3.66e-76	6	536	432	927

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MSY_A	4.13e-24	95	506	15	413	Glycosidehydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_B Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_C Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482]
3KZS_A	2.44e-21	95	506	15	413	Crystalstructure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_B Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_C Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_D Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482]
4QFU_A	4.55e-16	94	517	27	440	ChainA, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_B Chain B, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_C Chain C, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_D Chain D, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_E Chain E, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_F Chain F, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_G Chain G, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_H Chain H, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_I Chain I, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_J Chain J, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_K Chain K, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_L Chain L, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000037	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001665_00036.