CAZyme Information: MGYG000001665_00637

Basic Information

• Species: UMGS1322 sp900550765
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; QALW01; UMGS1322; UMGS1322 sp900550765
• CAZyme ID: MGYG000001665_00637
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
751		85694.79	5.0652

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001665	2160920	MAG	United States	North America

• Gene Location: Start: 11439; End: 13694 Strand: +

Full Sequence      

MMQWIGIPEDLWKKCGVFPGREIVSAYFCRSFWLEEVPDALRLRMSAQDQFKLWVNGQAV
LSGPCRGTRLCAYYDTLDVAPYVKKGKNMLAVEVVAYPQNPKDMNQIGPNYCYPGNEPLL
AAESDRLPLSEAAAWHVQINCSRRWEYSYPLLLGAMERVTAGDAPEGWNTNEAVWGAFPT
ARSRGDGAFNVYGELRGRWLQERPIPLLTREEGRFLNEQVLTVPPQSTKKMVFDAGRITT
AYFRLRVRGGEGARVRITYAESYKMEGENGELHKGLRDDPSGVIEGCADEYIASGQDAIY
EPFLFRTFRFVEVQVTTQNAAAEVVLLPYIETTYPLKARAEISSKQRWMEDLWTISVNTL
KHCMHDTYEDCPYYEQLQYAMDTRLEILFTYWLSGDTRLARRAIEDFSCSRMPDGLLQSR
YPSNAVQVIPGFSLYWILMLEDYYWQTGDIEFIRKYMGTAQGIAEAFYKKIGPGGLVQPM
GYWDFADWPKEWDAFHGEPAALKQGPSVLQNLLYVYALQSLSRLLTALQRKAAAVEYEKI
AADILAVIEARCFDFERGMYREGEHFEQYSQHTQVWAVLTGLASGARAQEVLTHALEEAD
VVACSFVMQFYLFRALEKAGMYARTLPLWENWRRLLAQHCTTVPEKPEEPRSDCHAWGAL
PLYEFTAKLLGVEPLVPGWEEIRITPRWDIVEELSGCVPTPRGDVLVRWSRERGSVHITV
QTPPQIPAFFYLPDGTREEISGGVLEKVIGL

Enzyme Prediction     

No EC number prediction in MGYG000001665_00637.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	228	728	4.2e-109	0.9801587301587301
CBM67	4	172	3.9e-19	0.8693181818181818

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	5.39e-19	350	659	14	330	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam05592	Bac_rhamnosid	1.59e-11	229	313	6	84	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	1.43e-10	671	743	1	74	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam06202	GDE_C	3.05e-06	399	561	51	219	Amylo-alpha-1,6-glucosidase. This family includes human glycogen branching enzyme AGL. This enzyme contains a number of distinct catalytic activities. It has been shown for the yeast homolog GDB1 that mutations in this region disrupt the enzymes Amylo-alpha-1,6-glucosidase (EC:3.2.1.33).
pfam17167	Glyco_hydro_36	7.47e-06	434	592	129	296	Glycosyl hydrolase 36 superfamily, catalytic domain. This is the catalytic region of the superfamily of enzymes referred to as GH36. UniProtKB:Q76IQ9 is a chitobiose phosphorylase that catalyzes the reversible phosphorolysis of chitobiose into alpha-GlcNAc-1-phosphate and GlcNAc with inversion of the anomeric configuration. The full-length enzyme comprises a beta sandwich domain and an (alpha/alpha)(6) barrel domain. The alpha-helical barrel component of the domain, this family, is the catalytic region.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALS28317.1	6.64e-204	3	743	11	788
QUI21033.1	1.36e-166	7	708	8	734
AIQ70316.1	2.63e-162	149	726	28	627
QNK59208.1	8.71e-162	4	742	7	764
QNK56541.1	1.29e-160	8	743	5	792

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OKX_A	6.36e-41	190	741	396	950	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
3CIH_A	2.83e-18	218	744	181	714	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000019	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001665_00637.