CAZyme Information: MGYG000001665_01527

Basic Information

• Species: UMGS1322 sp900550765
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; QALW01; UMGS1322; UMGS1322 sp900550765
• CAZyme ID: MGYG000001665_01527
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1648		185182.75	4.4499

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001665	2160920	MAG	United States	North America

• Gene Location: Start: 604; End: 5550 Strand: +

Full Sequence      

MKKIITWVLATVIALGTFSGVLIWQMNCKALEKMEPGEMKVCGLENPLGIDTNPVFSWQN
TAIGYAREMTAYRVIVSSTAENVEKENGDVWDSGKVESKDNYNVEYAGNALTSRTEYFWR
VCVWDENDEAVWSATHKFETGILNQNEWNAAWIKASVSSENAPMFRKEFSIDKQIKKARV
YISGLGLFEMKVNGERPDDTVLNPVETQYNITVDYRVFDITEMLTQGQNAVTVELGNGFY
NNDPVDGWYEGAPRMPGDLKFIAELIIEYTDGTNKKIFTDNSWKMFTDGPLTYNDMYMGE
KYDARLEIEGWDKAGFNDSDWPNAVKATAPAGKLRFQCIEPMRIIKKIDAKITNCGGGTF
IVALPVNTTGWARFRFNEPKNTKITMLYGENMRSEKEVSPVRWSNRNMQSYEYICKGGGE
EYFEPKFSYAGYQYIQVSGLNGTLTTDDVECYLIANDVEQTSTFETDNQLINTLHEMFAR
TLLNNFQGKPTDCPTWEKLGWTGDYDCVVKSIHFNYALKNFNAKFMGDMKADFLYAGSVP
TFSPRNHTYWSNCSTWNAAYIDGVYEAYRAYGDVALIREHYDQMRAQAQLYVNVLKEADS
NGVTDNEYGIVKRAWIWTNTDALNDWQGPNGESTAPEGSGIVGTAAAYRCIAELAEMAEV
IGKSTDAVEYQEYMANIYNAFNDAFYNEEKGYYDTGYWNPAYSGSGKRTKYRQTSNLVAV
AYGLCPEESLADVVKSIADDVIAKDYHLDTGSFGTKLILPVLSENGYADVAYKVINQVTM
PSWGFWVENGATTCWEGYPLNGTRSHNHYFLGTYDQWLFENVAGIADYTNGYATVTIDPE
YVGDLTYCRSTLKTVRGKLAIDWKRSDGITELSVVIPVGTTATVYLPAKEAADVLVNGQA
LADQKGIVSTTIENGRVKLVIKSGEYNFTAAEEIAKDIDALKADLNAVIDQANAIDTADY
ICGTELISRFEDALAAAKKSVSTSDKLQLITSKSTLEKVIEEIFENKKGNLAIGSSVTQS
GQMHGNWGGKENLVDGDRKNLSSGSEKQHQGWSSPGGENEAWVQIDLGGEYNINTVDLYP
TGNVETKKYYNCDWFPLSYNVQTSLDGDTWETVDVKQNVPIPVADEDHNAPVQRSMFETV
KARYIKVEVTDVRPENYEWWDVEHAYTPTFYAAQLAEIEVYNNVDANLRLMIEEAEKKDS
KNYSEQAWNEFSAVLQRLKNKEYTDNTDVEQAVNELAAAIEKLEEHLVGNIALGKNVLAS
QSAGGSAWDDPQKLTDGDRKNLNGTQHTGWSSSYGDNNAYVQIDLSREYTVNTVDIYPTG
LDEEHNKKCDWFPLSYKIQTSLDGNDWKTVDIKQNIPLPIADEHNNAPVQRSIFEAQRAR
YIRVQVTELRPEAKPWWASEDLTVLEQYAQFAEIEIYNMEHNLSYVSNGDGTHTIKCSHC
NYTGISNCFGGKATDVSKAVCDKCNGEYGELARKAKVENIEHGGVYYGDKAFKITDMSLV
RSVIIDDILVSSQNEEYTVTADNGAHKIKIIDWEDNIEEYVITVYKIYTVTFVADGKVIK
TEQVGYGKDAMLPEIPEKPDYNKTVPIWDKDGKNIIEDTIITAIYTPNVTDADSVESGDS
SIFLWAALLLISISFVTVVLKLRKMRQE

Enzyme Prediction     

No EC number prediction in MGYG000001665_01527.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	353	886	2.3e-130	0.996031746031746
CBM67	151	331	1.3e-36	0.9659090909090909
CBM32	1016	1163	1.5e-20	0.8467741935483871
CBM32	1261	1397	1e-19	0.8790322580645161

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	6.83e-79	459	822	1	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	1.30e-53	173	346	1	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	2.47e-18	356	454	4	101	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam00754	F5_F8_type_C	2.48e-15	1016	1151	1	114	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
pfam17390	Bac_rhamnosid_C	6.17e-15	824	887	1	64	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCI59736.1	1.91e-201	30	1182	35	1407
QNE21904.1	1.63e-164	45	930	26	877
ADB31696.1	6.30e-164	45	930	27	878
AQS56111.1	8.03e-159	104	1005	202	1091
AIY87265.1	8.50e-157	44	928	12	887

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	3.65e-155	27	928	23	939	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	6.28e-92	44	888	14	996	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	2.98e-90	48	889	16	849	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL4	2.46e-123	23	926	15	945	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
T2KNB2	7.10e-111	43	930	43	922	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	9.97e-97	23	928	15	908	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
Q82PP4	2.79e-91	44	888	14	996	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KM26	1.10e-09	51	141	488	577	Bifunctional sulfatase/alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22250 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.954871	0.043754	0.000857	0.000153	0.000093	0.000292

TMHMM  Annotations     

start	end
5	24
1621	1640