CAZyme Information: MGYG000001666_00810

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-873
• CAZyme ID: MGYG000001666_00810
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
378		42194.09	9.3406

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001666	2832137	MAG	United States	North America

• Gene Location: Start: 8910; End: 10046 Strand: +

Full Sequence      

MHYFLIAGEASGDLHGSRLIDELRAQDPQCVVTFIGGDKMAAASGQEPLIHCRDMAYMGF
SEVIRNLSKVRANLSRAREALKMAHPDCLILIDYPSFNLKVAATAAKACIPVYYYISPKI
WAWKKWRIKDIRRLVRRVFSILPFEPEYYRANGASAVYVGNPSLEEVDLRLRNQSGREAF
LAMHKLRDRPLVALMPGSRQGEIHNNLPVMNLALNQFPQYRGIIIGTPDISDRFYRENGA
GNLPILRPESAVDVLVHCRAALVTSGTATLETALTGIPQVALYRSNGAKITYDIMSKVLD
IKYVTLPNLIADLPIIPEQLIHLCTPALVAEKLGPLLREDTPEREAQLEGYRTMREKLGT
RKAAATTAAAIISDMRRL

Enzyme Prediction     

No EC number prediction in MGYG000001666_00810.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	359	3e-102	0.9915254237288136

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	4.88e-97	1	358	2	359	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	5.48e-95	4	361	5	365	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	8.07e-72	4	359	2	360	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	1.38e-61	5	359	10	370	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	1.89e-44	47	312	40	288	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQR08529.1	4.63e-127	1	371	1	370
ASB37800.1	4.63e-127	1	371	1	370
ANU64105.1	4.63e-127	1	371	1	370
QCD36425.1	6.28e-126	1	375	1	374
QCP71596.1	9.82e-104	1	372	1	388

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	6.77e-35	5	337	11	345	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	6.77e-35	5	337	11	345	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1D393	8.65e-64	5	372	9	375	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q2LVL8	5.62e-57	5	377	8	380	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
Q39T49	5.77e-57	5	360	11	365	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
C1F718	8.60e-57	4	360	8	373	Lipid-A-disaccharide synthase OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / BCRC 80197 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) OX=240015 GN=lpxB PE=3 SV=1
Q74AT9	1.86e-54	5	360	11	365	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000073	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001666_00810.