CAZyme Information: MGYG000001666_00963

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-873
• CAZyme ID: MGYG000001666_00963
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
368		43197.51	8.9795

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001666	2832137	MAG	United States	North America

• Gene Location: Start: 15328; End: 16434 Strand: +

Full Sequence      

MIKKLLALLILVVSFQCVSAQKSALKNFPQGYTPEEVGRRMAYRFVTEKHALHVGKWIGY
PETFYWSGSIRYANLTKDKSLMNLLQRRFEHLFNEESKYLPIMNHVDVNMFGSLPLWLYE
VTGDKRYKEVGMPYADTQWQCPDNASEKAKEWDRNGYSWQTRLWIDDMYMIPVVQTQAYK
VTGDRKYLDRTAREMVKYLDELQRPNGLFYHAPDVPFYWSRGNGWMAAGMTEMLKNMPKN
HPDRARIMDGYQKMMNSLLKYQNAEGLWNQLLDEPDFWTETSGSAMFLYAFINGVKHGWL
DAKTFAPVARKGWMALVDHINEKNQIDNVCEGTNKKNDKQYYYDRKRNLGDYHGQGPVLW
CVAALLEK

Enzyme Prediction     

No EC number prediction in MGYG000001666_00963.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	58	365	5.7e-75	0.9548192771084337

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	4.61e-54	59	361	28	335	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	1.12e-48	32	359	14	347	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDO68157.1	8.19e-211	1	368	1	368
ALJ59885.1	1.35e-209	1	368	1	368
QUT89090.1	1.35e-209	1	368	1	368
BCA52191.1	1.60e-203	1	368	1	367
QUT73021.1	1.60e-203	1	368	1	367

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3K11_A	8.69e-40	163	367	199	412	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
1NC5_A	2.34e-32	60	365	41	364	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	1.00e-31	60	365	31	354	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
4WU0_A	9.49e-22	59	359	24	352	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
5NOA_A	1.90e-20	155	316	153	324	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	1.28e-31	60	365	41	364	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
O31521	5.78e-21	66	367	31	337	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
P9WF04	1.18e-20	65	366	97	409	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
L7P9J4	1.36e-19	3	326	3	340	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
T2KPL9	7.28e-18	60	326	58	339	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000252	0.998916	0.000356	0.000163	0.000151	0.000141

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001666_00963.