CAZyme Information: MGYG000001666_01019

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-873
• CAZyme ID: MGYG000001666_01019
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
431	MGYG000001666_49|CGC1	48506.53	4.7421

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001666	2832137	MAG	United States	North America

• Gene Location: Start: 2407; End: 3702 Strand: -

Full Sequence      

MKQLIYGALTFAVVLGMFVGCRKVAPEASEPQFVTVRDGQFYIGDSVYRYIGTNMWYGAM
LGSIGQGGDRERLGRELDRLQDMGIDNIRVLAGADGAENLPAHVMPILQKEPGVYNDTIL
DGLDYFMAELEKRGMTAVIYLNNSWEWSGGYGEYLRWSGHGVCPIPGIDGYNTYVDHVAR
FVHDDSAKAMFADHVKFMVGRTNRYTGKPYTESPALMSWQICNEPRAFASDSVSKRLFAE
WIASTASLIKSIDKNHLFSTGSEGLYGCQVDLDLWTQIHSNPDVDYGLIHMWPVTWNWAR
RDSLYEDLDSAAFYSTEYVMSHVDAMRSAGKPLVLEEFGYPRDGMSYSVDSPTRARDEYY
TYVFSLMDSGLIQACNFWAWGGEAVPPHETWQKWDPYTGDPAQEPQGLYSVFATDSSTIG
IIKSYAGKYNK

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	71	380	2e-88	0.9930795847750865

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3934	COG3934	1.59e-34	22	427	29	463	Endo-1,4-beta-mannosidase [Carbohydrate transport and metabolism].
pfam01261	AP_endonuc_2	0.010	70	196	66	185	Xylose isomerase-like TIM barrel. This TIM alpha/beta barrel structure is found in xylose isomerase and in endonuclease IV (EC:3.1.21.2). This domain is also found in the N termini of bacterial myo-inositol catabolism proteins. These are involved in the myo-inositol catabolism pathway, and is required for growth on myo-inositol in Rhizobium leguminosarum bv. viciae.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD38974.1	1.83e-175	25	424	32	437
QCP72664.1	1.83e-175	25	424	32	437
ADY36271.1	4.88e-164	2	428	3	432
EFC70148.2	2.13e-161	15	424	1	410
QQA30547.1	1.03e-159	9	424	6	423

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1UUQ_A	1.67e-98	23	429	14	429	Exo-mannosidasefrom Cellvibrio mixtus [Cellvibrio mixtus],1UZ4_A Common inhibition of beta-glucosidase and beta-mannosidase by isofagomine lactam reflects different conformational intineraries for glucoside and mannoside hydrolysis [Cellvibrio mixtus],7ODJ_AAA Chain AAA, Man5A [Cellvibrio mixtus]
4LYP_A	2.68e-68	48	425	55	436	CrystalStructure of Glycoside Hydrolase Family 5 Mannosidase from Rhizomucor miehei [Rhizomucor miehei],4LYP_B Crystal Structure of Glycoside Hydrolase Family 5 Mannosidase from Rhizomucor miehei [Rhizomucor miehei]
4LYQ_A	2.06e-67	48	425	55	436	CrystalStructure of Glycoside Hydrolase Family 5 Mannosidase from Rhizomucor miehei, E202A mutant [Rhizomucor miehei],4NRR_A Crystal Structure of Glycoside Hydrolase Family 5 Mannosidase (E202A mutant) from Rhizomucor miehei in complex with mannosyl-fructose [Rhizomucor miehei],4NRR_B Crystal Structure of Glycoside Hydrolase Family 5 Mannosidase (E202A mutant) from Rhizomucor miehei in complex with mannosyl-fructose [Rhizomucor miehei],4NRS_A Crystal Structure of Glycoside Hydrolase Family 5 Mannosidase (E202A mutant) from Rhizomucor miehei in complex with mannobiose [Rhizomucor miehei],4NRS_B Crystal Structure of Glycoside Hydrolase Family 5 Mannosidase (E202A mutant) from Rhizomucor miehei in complex with mannobiose [Rhizomucor miehei]
4LYR_A	2.06e-67	48	425	55	436	GlycosideHydrolase Family 5 Mannosidase from Rhizomucor miehei, E301A mutant [Rhizomucor miehei]
3PZ9_A	1.37e-34	39	342	18	312	Nativestructure of endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3PZG_A I222 crystal form of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3PZI_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 in complex with beta-D-glucose [Thermotoga petrophila RKU-1],3PZM_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 with three glycerol molecules [Thermotoga petrophila RKU-1],3PZN_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 with citrate and glycerol [Thermotoga petrophila RKU-1],3PZO_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 in complex with three maltose molecules [Thermotoga petrophila RKU-1],3PZQ_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 with maltose and glycerol [Thermotoga petrophila RKU-1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q6Z310	1.64e-34	7	391	14	376	Putative mannan endo-1,4-beta-mannosidase 9 OS=Oryza sativa subsp. japonica OX=39947 GN=MAN9 PE=2 SV=2
Q10B67	4.86e-33	84	339	73	316	Mannan endo-1,4-beta-mannosidase 4 OS=Oryza sativa subsp. japonica OX=39947 GN=MAN4 PE=2 SV=2
Q9FZ03	2.30e-32	27	389	33	381	Mannan endo-1,4-beta-mannosidase 2 OS=Solanum lycopersicum OX=4081 GN=MAN2 PE=2 SV=2
Q6YM50	2.30e-32	27	389	33	381	Mannan endo-1,4-beta-mannosidase 5 OS=Solanum lycopersicum OX=4081 GN=MAN5 PE=2 SV=1
Q8L5J1	2.20e-30	108	370	98	351	Mannan endo-1,4-beta-mannosidase 4 OS=Solanum lycopersicum OX=4081 GN=MAN4 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000058	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001666_01019.