CAZyme Information: MGYG000001666_01129

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-873
• CAZyme ID: MGYG000001666_01129
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
775	MGYG000001666_57|CGC1	87699	5.6275

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001666	2832137	MAG	United States	North America

• Gene Location: Start: 6911; End: 9238 Strand: +

Full Sequence      

MLLAASALPMAAQSKLYPNEFDLQDVTLLPSRFSHAMELNTEVLLKYDVDRLLAPYLKAA
GLEPKAESFTCWDGLDGHVGGHYLSALAISYASTGNPELKKRMDYMLSELDRCQKASANG
YVGGVPDGKRLWEGIHNGDIGLIWKYWVPWYNVHKIYAGLRDAWLYAGSEEARRMFLEMC
DWGIYEISTLSDSQMEAMLDNEFGGMDEVYADAYAMTGDTKYLDTAKRFSHHWLLDSMAE
GIDNLDNKHANTQVPKVVGYQRIAELAHDSIYDNAARFFWDTVVNRRTLSLGGNSRREHF
APAADCISYVTDREGPESCNTNNMLKLTEGLFRMEPKAEYADFFERAMLNHILSTQHPGH
GGYVYFTPARPGHYRVYSQPNSAMWCCVGTGMENHGKYGQFIYTHTGDSLFVNLFVPSRL
NWKEKNISITQNTDFPESDKSRLTINLAKGKSARFDLLVRYPGWCSDMSVKVNGKPVKVT
AKPQSYVSIDRSWKDGDVVELTMPMSFRFETLPNVPEYVSVMYGPVLLASRFGNKDCDGL
IADESRWAHIANGPLVSVFDTPVLTGTKEQLEARLGKLKHVEGKPLSFMAEDEFGGLTLE
PFYNIHDSRYIMYWLTMTPEEYAAHIAQKKAEEEARLALDRRTVDAVNSGEQQPEADHFM
EFDRSKTGNYKDQSWRDASDGGFFSYRMKTGGADGLKLMVRYWGNENGKRDFDILVDNEV
LASETLTGKWGKEDFEEVVYEIPTRLTEGKAYVTVTFRSRPGTTAGGVFFVRLVR

Enzyme Prediction     

No EC number prediction in MGYG000001666_01129.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	25	529	1.5e-202	0.9980119284294234

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	0.0	25	529	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	4.90e-123	23	630	9	589	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam16375	DUF4986	4.63e-28	533	614	1	84	Domain of unknown function. This family around 150 residues locates in the C-terminal of some uncharacterized proteins in various Bacteroides and Bacillus species. The function of this family remains unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD36520.1	0.0	1	775	12	786
QCD43163.1	0.0	1	775	7	785
ADY37333.1	0.0	12	775	20	796
SCV06553.1	0.0	12	774	23	796
QRQ58640.1	0.0	12	774	23	796

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	6.06e-219	12	775	19	802	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	1.02e-211	12	775	19	802	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
5MQO_A	1.56e-21	317	505	381	579	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]
4QJY_A	6.89e-20	83	527	82	558	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	3.40e-18	269	527	285	558	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.881533	0.117747	0.000270	0.000221	0.000110	0.000165

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001666_01129.