CAZyme Information: MGYG000001666_02036

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-873
• CAZyme ID: MGYG000001666_02036
• CAZy Family: GT4
• CAZyme Description: Glycosyltransferase Gtf1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
403	MGYG000001666_168|CGC1	44483.37	8.3559

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001666	2832137	MAG	United States	North America

• Gene Location: Start: 1444; End: 2655 Strand: +

Full Sequence      

MKIVIVNHSDRLGGASVVSHRLMRALRALGHDARMLVSHKSSADHNVTQYEPQWSVKKSF
IAEHLRIFTSNGFNRSDLFKVSIAADTLSLADHPLIKNADAVILNWVNQGMLSLAEIERI
AATKKVIWTMHDMWNLTGICHHAGSCDKYTIGCHNCPLLHFMAGKKDLSNTTFLRKKAFY
EALPNLKLVAVSSWLRDKAARSALTANRHIDVIPNAFPLEDFYLKPKGGLDMIPKGKKII
LMGAARLDDPVKGLDYAVEILNKLNADDTIAVFFGEIRNREALAGLHFPHIHIGIVSDAA
ILRELYARATVVISTSLYETLPGTLIEGQAAGCTPVAFDSGGQRDIIEDGKTGYLIAPYD
TDVFAHTLMKAITDPFDPDTLRASVEQRFSASSVARKYIEIIG

Enzyme Prediction     

No EC number prediction in MGYG000001666_02036.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	235	375	2.8e-21	0.90625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03825	GT4_WcaC-like	1.30e-88	1	401	1	360	putative colanic acid biosynthesis glycosyl transferase WcaC and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. Escherichia coli WcaC has been predicted to function in colanic acid biosynthesis. WcfI in Bacteroides fragilis has been shown to be involved in the capsular polysaccharide biosynthesis.
cd03801	GT4_PimA-like	2.01e-38	2	402	1	365	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	1.98e-25	1	402	3	374	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03811	GT4_GT28_WabH-like	4.58e-25	2	383	1	336	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.
cd03823	GT4_ExpE7-like	1.01e-22	2	401	1	354	glycosyltransferase ExpE7 and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. ExpE7 in Sinorhizobium meliloti has been shown to be involved in the biosynthesis of galactoglucans (exopolysaccharide II).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD36841.1	8.90e-125	1	401	1	409
QCD41807.1	2.93e-105	2	401	23	430
QCP72361.1	2.76e-103	2	401	19	426
QCD38673.1	2.76e-103	2	401	19	426
QDO68538.1	1.43e-89	1	401	1	413

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000036	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001666_02036.