CAZyme Information: MGYG000001666_02093

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-873
• CAZyme ID: MGYG000001666_02093
• CAZy Family: GH51
• CAZyme Description: Extracellular exo-alpha-L-arabinofuranosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
360		40370.5	5.4267

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001666	2832137	MAG	United States	North America

• Gene Location: Start: 4016; End: 5098 Strand: +

Full Sequence      

MLVALCMGAALSLSAAGNVLEVQTNKVGAPIQPTMYGLFFEDINYAADGGLYAEMVKNRS
FEFPQNLLGWITYGGVEVKDDGPFERNPHYVRLTSAGHNDKHTGLENEGFFGVTYKKGAE
YRFSVWARTPDKSAKMRVELVNPASMGERHFAAQAEISVDSKEWKKYEVTLKPDESCDKG
RLRIFLAKPDNTTLDLEHISLFPADTWKGREGGLRKDLAQKLYDLNPGVFRFPGGCIVEG
TDLNTRYQWKNTVGPVENRPLNENRWHYTFPHRFYPDYYQSGGLGFFEFFQLSEDVGAEP
LPVLSVGLACQFQNHDASAHVPVAELQPYIQDALDLIEFANGDTTTIWGKLRAEMGHPAP

Enzyme Prediction     

EC	3.2.1.55

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3534	AbfA	8.65e-31	200	360	37	162	Alpha-L-arabinofuranosidase [Carbohydrate transport and metabolism].
pfam02018	CBM_4_9	2.44e-12	53	189	1	133	Carbohydrate binding domain. This family includes diverse carbohydrate binding domains.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD36526.1	3.84e-198	1	360	7	366
QCD41345.1	1.18e-188	4	360	11	365
QDO70909.1	1.30e-188	1	360	7	366
QUT90799.1	1.06e-187	1	359	7	365
ALJ58183.1	3.28e-187	4	359	2	357

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZPS_AAA	1.78e-43	22	360	3	340	ChainAAA, MgGH51 [Meripilus giganteus],6ZPV_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZPW_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZPX_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZPY_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZPZ_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZQ0_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZQ1_AAA Chain AAA, MgGH51 [Meripilus giganteus]
2C7F_A	4.57e-06	201	360	47	172	ChainA, Alpha-l-arabinofuranosidase [Acetivibrio thermocellus],2C7F_B Chain B, Alpha-l-arabinofuranosidase [Acetivibrio thermocellus],2C7F_C Chain C, Alpha-l-arabinofuranosidase [Acetivibrio thermocellus],2C7F_D Chain D, Alpha-l-arabinofuranosidase [Acetivibrio thermocellus],2C7F_E Chain E, Alpha-l-arabinofuranosidase [Acetivibrio thermocellus],2C7F_F Chain F, Alpha-l-arabinofuranosidase [Acetivibrio thermocellus],2C8N_A Chain A, ALPHA-L-ARABINOFURANOSIDASE [Acetivibrio thermocellus],2C8N_B Chain B, ALPHA-L-ARABINOFURANOSIDASE [Acetivibrio thermocellus],2C8N_C Chain C, ALPHA-L-ARABINOFURANOSIDASE [Acetivibrio thermocellus],2C8N_D Chain D, ALPHA-L-ARABINOFURANOSIDASE [Acetivibrio thermocellus],2C8N_E Chain E, ALPHA-L-ARABINOFURANOSIDASE [Acetivibrio thermocellus],2C8N_F Chain F, ALPHA-L-ARABINOFURANOSIDASE [Acetivibrio thermocellus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P82593	7.11e-74	28	360	45	369	Extracellular exo-alpha-L-arabinofuranosidase OS=Streptomyces chartreusis OX=1969 PE=1 SV=1
Q9SG80	7.08e-58	24	360	48	377	Alpha-L-arabinofuranosidase 1 OS=Arabidopsis thaliana OX=3702 GN=ASD1 PE=1 SV=1
Q8VZR2	1.77e-54	24	360	47	376	Alpha-L-arabinofuranosidase 2 OS=Arabidopsis thaliana OX=3702 GN=ASD2 PE=2 SV=1
U6A629	6.90e-51	13	360	11	345	Alpha-L-arabinofuranosidase A OS=Penicillium canescens OX=5083 GN=abfA PE=1 SV=1
B8NKA3	1.89e-42	17	360	25	357	Probable alpha-L-arabinofuranosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=abfA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.003631	0.995493	0.000213	0.000232	0.000187	0.000185

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001666_02093.