CAZyme Information: MGYG000001666_02152

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-873
• CAZyme ID: MGYG000001666_02152
• CAZy Family: GH36
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
607		69388.22	5.5651

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001666	2832137	MAG	United States	North America

• Gene Location: Start: 955; End: 2778 Strand: -

Full Sequence      

MKRIFVCALSALLGIMNTLAAEWQVRTASAGDIKVVCKQPGGWKFELQVDSIDGKEILAV
GLTSDSLRLPPRFDIIISVPQLDIHHLWRPGDMDRCQLRPDWMGYYSSHLAFDMPLYAFI
NGNNGNRLTVAASELLRNVDAQFGLVEEGCTLLGKLSYFNGPQTQMTRYETKIMLDPRSV
MWSEAIKEGAEWMTAEAALESVAAQEEAFAPLYSTWYNFHQNVTADRIEQECLEASRMGM
KTIILDDGWQTDDNNRGYAFCGDWKVSHNRFPDFASHVKRVQNMGMKYMVWYSVPYVGKK
SRNYERFKGKYLSESAEVCVLDPRFPEVREFLCSTYENAMKEYGLDGFKLDFIDSFRFDN
EDPAEADNYAGRDIKSLPAAIDILMKEIYRRLSAIKPDVLIEFRQRYMGPAMRQYGNMFR
AGDCPADLQSNRQRIANLRLTSGKSAVHSDMLEWNLTETPENAARHILSALFGVVQYSMM
LGELPENHTRVIKHWLDFSQKHRKTLLKSEFRPYHPEKCYPVIEAENDEELIVAVYDDMS
VPEMKTSGKRTYIINASGAPSLVLDMPAVPRRVAAYDVYGWETTAPEIIKGVQRVEVPLS
GYLQIEY

Enzyme Prediction     

No EC number prediction in MGYG000001666_02152.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH36	191	542	7.2e-34	0.5188953488372093

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	1.91e-59	208	498	1	296	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
pfam02065	Melibiase	2.38e-14	212	508	44	346	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.
cd06592	GH31_NET37	1.22e-13	211	352	3	151	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
COG1501	YicI	3.46e-07	219	451	269	509	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
cd06591	GH31_xylosidase_XylS	7.98e-07	262	436	56	239	xylosidase XylS-like. XylS is a glycosyl hydrolase family 31 (GH31) alpha-xylosidase found in prokaryotes, eukaryotes, and archaea, that catalyzes the release of alpha-xylose from the non-reducing terminal side of the alpha-xyloside substrate. XylS has been characterized in Sulfolobus solfataricus where it hydrolyzes isoprimeverose, the p-nitrophenyl-beta derivative of isoprimeverose, and xyloglucan oligosaccharides, and has transxylosidic activity. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. The XylS family corresponds to subgroup 3 in the Ernst et al classification of GH31 enzymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM46708.1	2.87e-175	41	607	17	587
QSF42796.1	1.42e-146	30	606	6	589
QTH41069.1	2.16e-143	41	603	17	586
AZN41080.1	7.10e-143	43	601	23	593
QOV11148.1	1.95e-142	71	606	45	586

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2YFN_A	9.89e-09	212	402	332	516	galactosidasedomain of alpha-galactosidase-sucrose kinase, AgaSK [[Ruminococcus] gnavus E1],2YFO_A GALACTOSIDASE DOMAIN OF ALPHA-GALACTOSIDASE-SUCROSE KINASE, AGASK, in complex with galactose [[Ruminococcus] gnavus E1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G4T4R7	6.00e-08	212	402	332	516	Bifunctional alpha-galactosidase/sucrose kinase AgaSK OS=Ruminococcus gnavus OX=33038 GN=agaSK PE=1 SV=1
Q5ARP5	7.16e-08	212	351	329	485	Probable alpha-galactosidase G OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=aglG PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000265	0.999105	0.000174	0.000154	0.000148	0.000143

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001666_02152.