CAZyme Information: MGYG000001666_02282

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-873
• CAZyme ID: MGYG000001666_02282
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
225	MGYG000001666_229|CGC1	26203.77	7.6743

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001666	2832137	MAG	United States	North America

• Gene Location: Start: 111; End: 788 Strand: -

Full Sequence      

MREVKTEIPRVIHYCWFGGKEKPADVLRMIASWRTVMPDYEIKEWNESNFDFGRFPYSRE
AYSMGDYAFVADVCRVYALTTEGGIYLDTDIEALKPFDPYLHDGSFCGYEHQGIGTGVIG
AEKGCAWTRRFLEFYSRRHYVNAFGHPVRTPNVRILSETILPSVADADRPEIYPIDYFCA
RNWETGEYSVSANTVCIHHYKASWRRRKTFGERLAILMRGLKARY

Enzyme Prediction     

No EC number prediction in MGYG000001666_02282.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	26	101	1.8e-19	0.9333333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3774	OCH1	1.02e-14	8	135	82	214	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
pfam04488	Gly_transf_sug	6.39e-12	23	99	1	85	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
pfam05704	Caps_synth	6.33e-09	7	106	45	149	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.
pfam12919	TcdA_TcdB	5.72e-06	10	90	93	193	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AQY21606.1	7.26e-63	8	204	2	207
ALJ57662.1	2.69e-60	8	204	2	207
QCO47524.1	5.44e-58	8	217	2	222
AII62854.1	4.91e-56	8	221	2	224
QJR67915.1	4.91e-56	8	221	2	224

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q10323	1.40e-06	8	124	57	177	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001666_02282.