CAZyme Information: MGYG000001668_00550

Basic Information

• Species: UBA1259 sp900760875
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Borkfalkiaceae; UBA1259; UBA1259 sp900760875
• CAZyme ID: MGYG000001668_00550
• CAZy Family: GT5
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
553		62358.26	9.1575

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001668	1885348	MAG	United States	North America

• Gene Location: Start: 1777; End: 3438 Strand: +

Full Sequence      

MTVKTTSVKAKTIPAKKPSSEAVTLPAKNADKKPVADVLPVTNKKPAAKKTVKKTTATKK
TSAAKSVKTVTKKLPEIKVTEKKKIVFFGSEAAPFIATGGLADVMGSLPKELAKNKDNEV
SVIIPLYKSISSEYKSKFRFLTNFNVSVGWRWQYAGVFYYEHEGVNFYFIDNEYYFGREG
NIYGFYDDGERFAFFSRAALDTLSRLDIYPDILQCNDWQTAASIVYLKGMYYADEKYRRI
KTVFTIHNIEYQGIFGMDTLGALFGFPDNLKDFVEFDGNVNLMKAAIEMSDLVNTVSPTY
AEEIKNSFYAHGLENIIARNSYKIYGILNGIDYDYYNPETDKYLFKNYSANDLSGKAVCK
EELQKLLGLPVRADVPIIAVISRLVSHKGLDLIRSTIESLLSSDVQVVILGKGEIAYENF
FTHTAYCYRGKCSAIIAYNQDLSRKIYSGADIFLMPSKTEPCGLSQMIASRYGTVPVVRE
TGGLNDSIKAYTGDAGNGFTFRDYNAHDMLYVINEAVRTYRDPANWKIVQNRAMTSDFSW
KASAEKYEWLYRQ

Enzyme Prediction     

No EC number prediction in MGYG000001668_00550.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	84	553	3.7e-174	0.9978813559322034

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0297	GlgA	0.0	84	553	2	477	Glycogen synthase [Carbohydrate transport and metabolism].
TIGR02095	glgA	0.0	84	553	2	472	glycogen/starch synthase, ADP-glucose type. This family consists of glycogen (or starch) synthases that use ADP-glucose (EC 2.4.1.21), rather than UDP-glucose (EC 2.4.1.11) as in animals, as the glucose donor. This enzyme is found in bacteria and plants. Whether the name given is glycogen synthase or starch synthase depends on context, and therefore on substrate. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
PRK00654	glgA	0.0	84	553	2	462	glycogen synthase GlgA.
cd03791	GT5_Glycogen_synthase_DULL1-like	0.0	84	553	1	474	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
PRK14098	PRK14098	1.41e-102	84	553	7	485	starch synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNL45767.1	1.28e-160	83	551	21	492
BCI60006.1	1.28e-157	84	552	2	470
QCT07141.1	1.67e-155	84	551	2	468
AGX05960.1	1.85e-155	84	551	2	471
AEV67748.1	2.89e-155	81	553	2	476

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4HLN_A	8.74e-81	75	551	119	622	Structureof barley starch synthase I in complex with maltooligosaccharide [Hordeum vulgare]
3D1J_A	1.50e-80	84	551	2	473	ChainA, Glycogen synthase [Escherichia coli]
2QZS_A	5.15e-80	90	551	8	473	CrystalStructure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSb) [Escherichia coli],2R4T_A Crystal Structure of Wild-type E.coli GS in Complex with ADP and Glucose(wtGSc) [Escherichia coli],2R4U_A Crystal Structure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSd) [Escherichia coli],3GUH_A Crystal Structure of Wild-type E.coli GS in complex with ADP and DGM [Escherichia coli K-12]
3COP_A	3.94e-79	90	551	8	473	ChainA, Glycogen synthase [Escherichia coli],3CX4_A Chain A, Glycogen synthase [Escherichia coli]
6GNE_A	1.98e-78	85	551	12	494	Catalyticdomain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana],6GNE_B Catalytic domain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0PY73	6.73e-149	85	551	3	472	Glycogen synthase OS=Clostridium novyi (strain NT) OX=386415 GN=glgA PE=3 SV=1
Q97GX6	1.79e-148	84	551	2	473	Glycogen synthase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=glgA PE=3 SV=1
Q1WSN1	2.24e-146	84	553	2	474	Glycogen synthase OS=Ligilactobacillus salivarius (strain UCC118) OX=362948 GN=glgA PE=3 SV=1
B2V049	4.78e-146	84	553	2	474	Glycogen synthase OS=Clostridium botulinum (strain Alaska E43 / Type E3) OX=508767 GN=glgA PE=3 SV=1
A4J4I4	8.22e-145	84	553	2	473	Glycogen synthase OS=Desulfotomaculum reducens (strain MI-1) OX=349161 GN=glgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000033	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001668_00550.