CAZyme Information: MGYG000001668_00659

Basic Information

• Species: UBA1259 sp900760875
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Borkfalkiaceae; UBA1259; UBA1259 sp900760875
• CAZyme ID: MGYG000001668_00659
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
862	MGYG000001668_53|CGC1	97154.1	7.7727

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001668	1885348	MAG	United States	North America

• Gene Location: Start: 1544; End: 4132 Strand: +

Full Sequence      

MRLKLLCNYLNNPDNVFGNAVLFTAEASDGKADAFLFRILDRDRVIEERKIVSERFLPQR
VDLSCLRHDAEYLWSVTAFYRGKKAGFARAKFKTAFLPEKGEWIGAPFDTENVIEIYKSF
SLKKRPVAARLFICGLGFFESKINGKRTDDGYFKPLFTDYEQRDITKNSSIPQSDFHRVA
AYVFNCGKLLKKGENSLSVLLGDGYYKNEDKKEEPFVSFGERKVVFELKITYADGEERVF
SDCTSLAREKAMRSALFNGDYFDFGKSDGTFVPVVKARPVGGKFFFSPVPSDSVCASISP
VSVKTEKDGILYDFGINLSGGLRFYIIGEKGQKITAEFAECLNADGSLNLGTSSWEDFDC
EAKKEHVIIQRAEYILSGGKDEIKPLFCWRCFRFVKFYGVKNAKIFAMRAEFIHTDVKED
GKFDCSEENLKRFYRAARLTFFDNLHCGVLSDCPHREKRPYTGDGQIVAEAMTDMFNAAA
FYEKWLADIAGSARNDGFVPYSAPYMGGGGGYAWSSAIAVVPERLYNITGDARFIDLAFP
ALVKWIGYCEAHSENHLPVRSEESWQLGDWLSPEVCAFDLSLMNACWYYYSVAAAERFAK
IKGETELNKKFAEQKKKIAAAINEKYLDRERAIYGSGVQGENIFPLYLGIVPETVKEKLI
RGVRASYEKSDYAIDTGIVITGLLFKTLADNAMADVALKILKRKEYPSYEFLLENETTLS
EHWAKKWPDYKFGPDSEVVKGGGDVSHCHPMFGSVAEFAFSYAGGLDISELYKGKILVRT
VVLKYLNSAKTEKTSIFGKISVEWKKSREEGRLKIKLPAGVGADILLAAGTEEKRFLRGR
GIRRDENVISITESAEIIVKIL

Enzyme Prediction     

No EC number prediction in MGYG000001668_00659.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	304	825	1.6e-111	0.9900793650793651

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.38e-77	418	762	1	339	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	1.65e-21	124	263	1	129	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	2.22e-08	304	396	2	83	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	1.41e-04	772	834	9	70	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCJ98018.1	8.80e-113	66	827	85	858
QOY86540.1	2.89e-98	3	835	28	850
QBE96295.1	6.14e-96	4	833	10	837
QMW80401.1	3.23e-95	4	833	11	838
QIB56822.1	3.23e-95	4	833	11	838

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	2.97e-67	105	825	164	896	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
6GSZ_A	7.01e-38	110	804	128	816	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL4	6.28e-48	121	852	192	932	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
P9WF03	3.91e-41	100	826	147	877	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000084	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001668_00659.